StarFunc result for job id P05787

User Input

>input (483 residues)
MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGM
GGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLE
TKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYE
DEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQIS
DTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDL
RRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAAL
QRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYA
GGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDV
LPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11679	0.364	0.360	3.140E-40	490	0.899	0.886	P11679.pdb.gz	K2C8_MOUSE Keratin, type II cytoskeletal 8 OS=Mus musculus OX=10090 GN=Krt8 PE=1 SV=4
2	AFDB:F1QV31	0.486	0.423	1.077E-25	566	0.629	0.537	F1QV31.pdb.gz	F1QV31_DANRE Keratin 5 OS=Danio rerio OX=7955 GN=ckii PE=1 SV=1
3	AFDB:Q8BGZ7	0.485	0.434	3.734E-24	551	0.600	0.526	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
4	AFDB:Q9DCV7	0.605	0.634	5.771E-24	457	0.584	0.617	Q9DCV7.pdb.gz	K2C7_MOUSE Keratin, type II cytoskeletal 7 OS=Mus musculus OX=10090 GN=Krt7 PE=1 SV=1
5	AFDB:A0A1D5PXP0	0.420	0.391	1.217E-23	522	0.621	0.575	A0A1D5PXP0.pdb.gz
6	AFDB:Q922U2	0.495	0.426	2.131E-23	580	0.576	0.479	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
7	AFDB:Q6PVZ5	0.419	0.345	2.733E-23	599	0.596	0.481	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
8	AFDB:P13647	0.423	0.359	3.095E-23	590	0.586	0.480	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
9	AFDB:O95678	0.378	0.339	3.970E-23	551	0.598	0.525	O95678.pdb.gz	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
10	AFDB:P02538	0.406	0.359	7.870E-23	564	0.600	0.514	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
11	PDB:3o61D	0.047	0.102	1.222	190	0.006	0.016	3o61D.pdb.gz	Structural studies of the Nudix GDP-mannose hydrolase from E. coli reveals a new motif for mannose recognition.
12	PDB:6itdA	0.043	0.061	3.108	328	0.012	0.018	6itdA.pdb.gz	A suicide enzyme catalyzes multiple reactions for biotin biosynthesis in cyanobacteria.
13	PDB:2pmqB	0.046	0.059	3.986	374	0.017	0.021	2pmqB.pdb.gz	Discovery of new enzymes and metabolic pathways by using structure and genome context.
14	PDB:1g9qA	0.043	0.092	4.242	205	0.006	0.015	1g9qA.pdb.gz	The structure of ADP-ribose pyrophosphatase reveals the structural basis for the versatility of the Nudix family.
15	PDB:3ngyC	0.042	0.094	4.242	182	0.004	0.011	3ngyC.pdb.gz	Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
16	PDB:7b04A	0.034	0.039	5.440	409	0.010	0.012	7b04A.pdb.gz	Structural and functional characterization of the intracellular filament-forming nitrite oxidoreductase multiprotein complex
17	PDB:7p7wBBB	0.045	0.071	5.440	306	0.006	0.010	7p7wBBB.pdb.gz	Structure and function of N-acetylglucosamine kinase illuminates the catalytic mechanism of ROK kinases
18	PDB:1szqA	0.043	0.044	5.790	473	0.010	0.011	1szqA.pdb.gz
19	PDB:4fu0A	0.046	0.064	5.790	343	0.010	0.015	4fu0A.pdb.gz	Structural and functional characterization of VanG D-Ala:D-Ser ligase associated with vancomycin resistance in Enterococcus faecalis
20	PDB:3gyxB	0.044	0.121	6.161	166	0.006	0.018	3gyxB.pdb.gz	Crystal structure of Adenylylsulfate reductase from Desulfovibrio gigas suggests a potential self-regulation mechanism involving the C terminus of the beta-subunit

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QV31	0.0	558	566	0.561	0.479	F1QV31_DANRE Keratin 5 OS=Danio rerio OX=7955 GN=ckii PE=1 SV=1
2	P05787	0.0	971	483	1.000	1.000	K2C8_HUMAN Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7
3	P11679	0.0	795	490	0.901	0.888	K2C8_MOUSE Keratin, type II cytoskeletal 8 OS=Mus musculus OX=10090 GN=Krt8 PE=1 SV=4
4	Q10758	0.0	823	483	0.886	0.886	K2C8_RAT Keratin, type II cytoskeletal 8 OS=Rattus norvegicus OX=10116 GN=Krt8 PE=1 SV=3
5	Q6P3K5	0.0	556	553	0.561	0.490	Q6P3K5_DANRE Krt5 protein OS=Danio rerio OX=7955 GN=krt5 PE=2 SV=1
6	Q9DCV7	0.0	524	457	0.588	0.621	K2C7_MOUSE Keratin, type II cytoskeletal 7 OS=Mus musculus OX=10090 GN=Krt7 PE=1 SV=1
7	Q6P6Q2	3.83e-180	518	576	0.536	0.450	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
8	Q8BGZ7	1.13e-179	516	551	0.532	0.466	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
9	P13647	2.74e-179	517	590	0.520	0.425	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
10	O95678	8.74e-179	514	551	0.553	0.485	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
11	Q922U2	3.72e-178	513	580	0.526	0.438	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
12	P02538	6.77e-178	512	564	0.532	0.456	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
13	P48668	7.39e-178	512	564	0.534	0.457	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
14	Q6PVZ5	1.25e-177	513	599	0.526	0.424	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
15	P50446	2.08e-177	511	553	0.524	0.458	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
16	P04259	5.79e-177	510	564	0.530	0.454	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
17	P08729	1.12e-174	501	469	0.578	0.595	K2C7_HUMAN Keratin, type II cytoskeletal 7 OS=Homo sapiens OX=9606 GN=KRT7 PE=1 SV=5
18	Q9Z331	1.64e-174	504	562	0.513	0.441	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
19	Q3UV17	3.27e-166	484	594	0.495	0.402	K22O_MOUSE Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1
20	Q6IFZ5	3.90e-166	483	581	0.497	0.413	Q6IFZ5_RAT Keratin 76 OS=Rattus norvegicus OX=10116 GN=Krt76 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16326 ABC_tran_CTD	8.6e+02	11.6	ABC transporter C-terminal domain
2	PF11559 ADIP	2	20.0	Afadin- and alpha -actinin-Binding
3	PF08614 ATG16	3.3e+02	12.9	Autophagy protein 16 (ATG16)
4	PF07888 CALCOCO1	6.8	17.1	Calcium binding and coiled-coil domain (CALCOCO1) like
5	PF10473 CENP-F_leu_zip	0.73	21.3	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
6	PF19220 Crescentin	2.7e+02	12.0	Crescentin protein
7	PF04977 DivIC	47	15.2	Septum formation initiator
8	PF00038 Filament	1.4e-114	394.6	Intermediate filament protein
9	PF11427 HTH_Tnp_Tc3_1	3e+02	12.7	Tc3 transposase
10	PF16208 Keratin_2_head	5.1e-08	44.7	Keratin type II head
11	PF09728 Taxilin	46	14.7	Myosin-like coiled-coil protein
12	PF16331 TolA_bind_tri	8.7	17.8	TolA binding protein trimerisation
13	PF07926 TPR_MLP1_2	0.75	21.3	TPR/MLP1/MLP2-like protein
14	PF07820 TraC	2.7e+02	13.4	TraC-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000449404

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373487	0.995	Keratin, type I cytoskeletal 18
2	9606.ENSP00000308938	0.962	Plasminogen
3	9606.ENSP00000229795	0.950	Mitogen-activated protein kinase 14
4	9606.ENSP00000003084	0.941	Cystic fibrosis transmembrane conductance regulator
5	9606.ENSP00000340510	0.905	Periplakin
6	9606.ENSP00000333685	0.904	Mitogen-activated protein kinase 11
7	9606.ENSP00000361850	0.841	Urokinase-type plasminogen activator
8	9606.ENSP00000369129	0.838	Desmoplakin
9	9606.ENSP00000261769	0.825	Cadherin-1
10	9606.ENSP00000263735	0.816	Epithelial cell adhesion molecule
11	9606.ENSP00000356985	0.795	Death effector domain-containing protein
12	9606.ENSP00000355124	0.789	Keratin, type I cytoskeletal 19
13	9606.ENSP00000321239	0.772	RING finger and CHY zinc finger domain-containing protein 1
14	9606.ENSP00000331678	0.737	Plakophilin-3
15	9606.ENSP00000379138	0.723	Alpha-fetoprotein
16	9606.ENSP00000346032	0.718	Annexin A2
17	9606.ENSP00000263946	0.705	Plakophilin-1
18	9606.ENSP00000349208	0.698	Piwi-like protein 2
19	9606.ENSP00000302961	0.689	Heat shock protein family A member 4
20	9606.ENSP00000269571	0.677	Receptor tyrosine-protein kinase erbB-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.958	structural molecule activity
GO:0097110	0.354	scaffold protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050896	0.963	response to stimulus
GO:0048856	0.958	anatomical structure development
GO:0050789	0.883	regulation of biological process
GO:0050794	0.868	regulation of cellular process
GO:0032501	0.574	multicellular organismal process
GO:0051716	0.501	cellular response to stimulus
GO:0071840	0.423	cellular component organization or biogenesis
GO:0007154	0.383	cell communication
GO:0016043	0.377	cellular component organization
GO:0023052	0.369	signaling
GO:0007165	0.363	signal transduction
GO:0042221	0.338	response to chemical
GO:0048513	0.310	animal organ development
GO:0007275	0.309	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005737	0.991	cytoplasm
GO:0005856	0.991	cytoskeleton
GO:0043227	0.987	membrane-bounded organelle
GO:0005882	0.976	intermediate filament
GO:0005576	0.959	extracellular region
GO:0016020	0.940	membrane
GO:0043231	0.939	intracellular membrane-bounded organelle
GO:0005829	0.938	cytosol
GO:0071944	0.873	cell periphery
GO:0005886	0.835	plasma membrane
GO:0005615	0.833	extracellular space
GO:0005634	0.825	nucleus
GO:0031982	0.805	vesicle
GO:0045095	0.799	keratin filament
GO:0065010	0.776	extracellular membrane-bounded organelle
GO:1903561	0.751	extracellular vesicle
GO:0070062	0.741	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]