StarFunc result for job id P05814

User Input

>input (226 residues)
MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQ
PQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKS
PTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIP
QQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05814	1.000	1.000	1.557E-32	226	1.000	1.000	P05814.pdb.gz	CASB_HUMAN Beta-casein OS=Homo sapiens OX=9606 GN=CSN2 PE=1 SV=4
2	AFDB:P02666	0.139	0.140	6.270E-11	224	0.562	0.567	P02666.pdb.gz	CASB_BOVIN Beta-casein OS=Bos taurus OX=9913 GN=CSN2 PE=1 SV=2
3	AFDB:Q389C9	0.116	0.050	1.382	791	0.164	0.047	Q389C9.pdb.gz	Q389C9_TRYB2 Acyltransferase 3 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1600 PE=4 SV=1
4	AFDB:Q5AND6	0.122	0.080	2.081	410	0.150	0.083	Q5AND6.pdb.gz	Q5AND6_CANAL Fgr44p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FGR44 PE=4 SV=1
5	AFDB:Q9M2R1	0.094	0.089	2.228	243	0.124	0.115	Q9M2R1.pdb.gz	GIG1_ARATH Protein GIGAS CELL1 OS=Arabidopsis thaliana OX=3702 GN=GIG1 PE=1 SV=1
6	AFDB:C9JE40	0.114	0.060	2.734	543	0.142	0.059	C9JE40.pdb.gz	PATL2_HUMAN Protein PAT1 homolog 2 OS=Homo sapiens OX=9606 GN=PATL2 PE=1 SV=1
7	AFDB:Q12507	0.111	0.078	2.927	346	0.119	0.078	Q12507.pdb.gz	SFG1_YEAST Superficial pseudohyphal growth protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFG1 PE=1 SV=1
8	AFDB:A2ARM1	0.082	0.040	3.134	529	0.115	0.049	A2ARM1.pdb.gz	PATL2_MOUSE Protein PAT1 homolog 2 OS=Mus musculus OX=10090 GN=Patl2 PE=2 SV=1
9	AFDB:X2JCG3	0.103	0.040	3.846	770	0.097	0.029	X2JCG3.pdb.gz	X2JCG3_DROME PH-sensitive chloride channel 1, isoform T OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=2
10	AFDB:Q4WER3	0.134	0.074	4.720	491	0.142	0.065	Q4WER3.pdb.gz	HAPX_ASPFU bZIP transcription factor hapX OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=hapX PE=2 SV=1
11	PDB:7dvqR	0.119	0.116	7.307	241	0.080	0.075	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05814	1.74e-155	432	226	1.000	1.000	CASB_HUMAN Beta-casein OS=Homo sapiens OX=9606 GN=CSN2 PE=1 SV=4
2	W5RWE1	1.74e-155	432	226	1.000	1.000	W5RWE1_HUMAN Beta-casein OS=Homo sapiens OX=9606 GN=CSN2 PE=1 SV=1
3	P02666	5.92e-49	161	224	0.496	0.500	CASB_BOVIN Beta-casein OS=Bos taurus OX=9913 GN=CSN2 PE=1 SV=2
4	T1T0C1	8.05e-48	159	224	0.491	0.496	T1T0C1_BOVIN Beta-casein OS=Bos taurus OX=9913 GN=csn2 PE=2 SV=1
5	P10598	7.80e-30	112	231	0.460	0.450	CASB_MOUSE Beta-casein OS=Mus musculus OX=10090 GN=Csn2 PE=2 SV=1
6	J9UJ96	2.11e-11	60.1	77	0.186	0.545	J9UJ96_BOVIN Beta-casein (Fragment) OS=Bos taurus OX=9913 GN=CSN2 PE=4 SV=1
7	J9UHS4	5.47e-11	58.9	77	0.181	0.532	J9UHS4_BOVIN Beta-casein (Fragment) OS=Bos taurus OX=9913 GN=CSN2 PE=4 SV=1
8	M9PCJ6	7.88e-04	42.7	18641	0.190	0.002	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PC48	0.001	42.4	18095	0.190	0.002	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PBZ0	0.003	40.8	22830	0.190	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PB30	0.004	40.8	22949	0.190	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
12	M9PC41	0.004	40.8	22743	0.190	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PC45	0.004	40.8	22300	0.190	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PEH5	0.004	40.8	20710	0.190	0.002	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PEI1	0.004	40.8	21657	0.190	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PB31	0.010	39.3	20404	0.195	0.002	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	G5EBV0	0.46	33.9	723	0.119	0.037	EGL9_CAEEL Hypoxia-inducible factor prolyl hydroxylase OS=Caenorhabditis elegans OX=6239 GN=egl-9 PE=1 SV=1
18	P47710	1.4	31.6	185	0.106	0.130	CASA1_HUMAN Alpha-S1-casein OS=Homo sapiens OX=9606 GN=CSN1S1 PE=1 SV=1
19	Q9PVF5	1.5	32.3	1207	0.173	0.032	Q9PVF5_DANRE Calymmin OS=Danio rerio OX=7955 GN=wu:fd07b03 PE=2 SV=1
20	Q22667	1.9	32.0	747	0.075	0.023	Q22667_CAEEL Junctophilin-1 OS=Caenorhabditis elegans OX=6239 GN=jph-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00363 Casein	1.7e-21	87.8	Casein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341030

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246891	0.976	Alpha-S1-casein
2	9606.ENSP00000341208	0.971	Signal transducer and activator of transcription 5A
3	9606.ENSP00000301046	0.962	Alpha-lactalbumin
4	9606.ENSP00000304822	0.952	Kappa-casein
5	9606.ENSP00000342235	0.934	Receptor tyrosine-protein kinase erbB-4
6	9606.ENSP00000302150	0.821	Prolactin
7	9606.ENSP00000258080	0.810	Serine protease HTRA2, mitochondrial
8	9606.ENSP00000295897	0.772	Serum albumin
9	9606.ENSP00000238616	0.702	Serine/threonine-protein kinase Nek9
10	9606.ENSP00000293328	0.690	Signal transducer and activator of transcription 5B
11	9606.ENSP00000482954	0.688	Prolactin receptor
12	9606.ENSP00000417898	0.653	Glycodelin
13	9606.ENSP00000349351	0.645	Protein bicaudal D homolog 2
14	9606.ENSP00000322323	0.639	Extracellular serine/threonine protein kinase FAM20C
15	9606.ENSP00000440864	0.639	Nuclear receptor subfamily 4 group A member 1
16	9606.ENSP00000365042	0.625	Casein kinase II subunit beta
17	9606.ENSP00000356355	0.607	Serine/threonine-protein kinase Nek7
18	9606.ENSP00000380489	0.605	Myoglobin
19	9606.ENSP00000380432	0.592	Insulin
20	9606.ENSP00000244513	0.580	Butyrophilin subfamily 1 member A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.996	ion binding
GO:0004869	0.995	cysteine-type endopeptidase inhibitor activity
GO:0005509	0.976	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0051246	0.979	regulation of protein metabolic process
GO:0050790	0.977	regulation of catalytic activity
GO:0051172	0.973	negative regulation of nitrogen compound metabolic process
GO:0010605	0.973	negative regulation of macromolecule metabolic process
GO:0048856	0.972	anatomical structure development
GO:0030162	0.971	regulation of proteolysis
GO:0051336	0.967	regulation of hydrolase activity
GO:0044092	0.964	negative regulation of molecular function
GO:0051248	0.956	negative regulation of protein metabolic process
GO:0043086	0.952	negative regulation of catalytic activity
GO:0065008	0.947	regulation of biological quality
GO:0045861	0.945	negative regulation of proteolysis
GO:0051346	0.937	negative regulation of hydrolase activity
GO:0051234	0.935	establishment of localization
GO:0006810	0.933	transport
GO:0048513	0.931	animal organ development
GO:0052547	0.925	regulation of peptidase activity
GO:0007589	0.917	body fluid secretion
GO:0048732	0.899	gland development
GO:0010466	0.899	negative regulation of peptidase activity
GO:0052548	0.889	regulation of endopeptidase activity
GO:0007595	0.886	lactation
GO:0050794	0.860	regulation of cellular process
GO:2000116	0.826	regulation of cysteine-type endopeptidase activity
GO:0010951	0.820	negative regulation of endopeptidase activity
GO:0050896	0.809	response to stimulus
GO:2000117	0.773	negative regulation of cysteine-type endopeptidase activity
GO:0006811	0.759	monoatomic ion transport
GO:0071702	0.702	organic substance transport
GO:0030001	0.666	metal ion transport
GO:0009987	0.658	cellular process
GO:0048518	0.630	positive regulation of biological process
GO:0031323	0.506	regulation of cellular metabolic process
GO:0048523	0.408	negative regulation of cellular process
GO:0048583	0.386	regulation of response to stimulus
GO:0042221	0.372	response to chemical
GO:0023051	0.368	regulation of signaling
GO:0010646	0.368	regulation of cell communication
GO:0009966	0.362	regulation of signal transduction
GO:0006816	0.354	calcium ion transport
GO:0009893	0.345	positive regulation of metabolic process
GO:0048522	0.326	positive regulation of cellular process
GO:0008152	0.314	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0070013	0.960	intracellular organelle lumen
GO:0043231	0.941	intracellular membrane-bounded organelle
GO:0005737	0.923	cytoplasm
GO:0012505	0.719	endomembrane system
GO:0005634	0.473	nucleus
GO:0016020	0.376	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]