StarFunc result for job id P05997

User Input

>input (1499 residues)
MMANWAEARPLLILIVLLGQFVSIKAQEEDEDEGYGEEIACTQNGQMYLNRDIWKPAPCQ
ICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGL
VPVVTGIRGRPGPAGPPGSQGPRGERGPKGRPGPRGPQGIDGEPGVPGQPGAPGPPGHPS
HPGPDGLSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGAGPTGPPG
EPGDPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKG
HRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGQRGAHG
MPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPG
AIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAG
PKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKG
AQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPG
PPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPG
LAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERG
EPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRG
GIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENG
PTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRG
TQGPPGATGFPGSAGRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAG
PPGGPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVG
PTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPG
SQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRG
QKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPG
VRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDESMPDPLPEFTEDQAAPDD
KNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSV
EDAIKVYCNMETGETCISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFAYGDHQSP
NTAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIR
FRYIVLQDTCSKRNGNVGKTVFEYRTQNVARLPIIDLAPVDVGGTDQEFGVEIGPVCFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LQ00	0.196	0.197	0.000	1494	0.935	0.938	F1LQ00.pdb.gz	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
2	AFDB:Q2LDA1	0.176	0.177	2.214E-84	1491	0.639	0.643	Q2LDA1.pdb.gz	Q2LDA1_DANRE Collagen alpha-1(II) chain precursor OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
3	AFDB:P02458	0.177	0.179	3.254E-83	1487	0.645	0.650	P02458.pdb.gz	CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens OX=9606 GN=COL2A1 PE=1 SV=3
4	AFDB:P02452	0.186	0.191	2.604E-75	1464	0.593	0.607	P02452.pdb.gz	CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=6
5	AFDB:F1QJC9	0.171	0.177	2.913E-75	1447	0.581	0.602	F1QJC9.pdb.gz
6	AFDB:A0A0H2UKU2	0.163	0.181	1.541E-72	1344	0.592	0.660	A0A0H2UKU2.pdb.gz
7	AFDB:F1QDL1	0.167	0.172	1.531E-71	1449	0.560	0.579	F1QDL1.pdb.gz
8	AFDB:P02461	0.159	0.162	2.129E-62	1466	0.545	0.557	P02461.pdb.gz	CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens OX=9606 GN=COL3A1 PE=1 SV=4
9	AFDB:Q6IQX2	0.178	0.196	1.381E-56	1352	0.522	0.578	Q6IQX2.pdb.gz	Q6IQX2_DANRE Collagen alpha-2(I) chain precursor OS=Danio rerio OX=7955 GN=alpha2(I) PE=1 SV=1
10	AFDB:P12105	0.158	0.187	8.284E-56	1262	0.462	0.549	P12105.pdb.gz	CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus OX=9031 GN=COL3A1 PE=2 SV=2
11	PDB:1ei3C	0.045	0.136	1.760E-1	397	0.017	0.065	1ei3C.pdb.gz
12	PDB:4fixA	0.045	0.096	1.969E-1	629	0.007	0.017	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
13	PDB:7emzA	0.058	0.204	1.969E-1	278	0.015	0.083	7emzA.pdb.gz	Molecular insights into the endoperoxide formation by Fe(II)/ alpha-KG-dependent oxygenase NvfI.
14	PDB:7bvfA	0.051	0.066	2.755E-1	1087	0.014	0.019	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
15	PDB:3v0aB	0.061	0.073	2.914E-1	1150	0.012	0.016	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
16	PDB:5ffoG	0.054	0.169	2.914E-1	297	0.009	0.047	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
17	PDB:4zkqA	0.031	0.089	3.081E-1	388	0.005	0.021	4zkqA.pdb.gz
18	PDB:2e31A	0.041	0.168	5.100E-1	246	0.009	0.057	2e31A.pdb.gz
19	PDB:2fmdA	0.052	0.195	5.100E-1	232	0.018	0.116	2fmdA.pdb.gz	Structural basis of carbohydrate recognition by a Man(alpha1-2)Man-specific lectin from Bowringia milbraedii.
20	PDB:3rjrC	0.049	0.138	5.705E-1	343	0.011	0.047	3rjrC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3H5	817	1366	0.492	0.540	A0A0S2Z3H5_HUMAN Collagen type I alpha 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=COL1A2 PE=2 SV=1
2	A0A8I6AII1	2081	1497	0.943	0.944	A0A8I6AII1_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=1
3	A0A8I6GEX8	2099	1498	0.947	0.948	A0A8I6GEX8_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=4 SV=1
4	B3DLK0	1014	1421	0.608	0.641	B3DLK0_DANRE Col2a1a protein OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
5	F1LQ00	2077	1499	0.931	0.931	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
6	L0S5L0	1016	1493	0.555	0.557	L0S5L0_DANRE Collagen type II, alpha-1b OS=Danio rerio OX=7955 GN=im:6788778 PE=2 SV=1
7	P02452	781	1464	0.513	0.525	CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=6
8	P02453	784	1463	0.516	0.528	CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus OX=9913 GN=COL1A1 PE=1 SV=3
9	P02454	803	1453	0.513	0.529	CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a1 PE=1 SV=5
10	P02466	948	1372	0.506	0.552	CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3
11	P02467	811	1363	0.504	0.554	CO1A2_CHICK Collagen alpha-2(I) chain OS=Gallus gallus OX=9031 GN=COL1A2 PE=1 SV=3
12	P05539	1031	1419	0.614	0.649	CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus OX=10116 GN=Col2a1 PE=1 SV=2
13	P05997	2734	1499	1.000	1.000	CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens OX=9606 GN=COL5A2 PE=1 SV=3
14	P08123	817	1366	0.492	0.540	CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens OX=9606 GN=COL1A2 PE=1 SV=7
15	P11087	814	1453	0.514	0.531	CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus OX=10090 GN=Col1a1 PE=1 SV=4
16	P28481	1106	1487	0.642	0.648	CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus OX=10090 GN=Col2a1 PE=1 SV=2
17	Q01149	921	1372	0.502	0.549	CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus OX=10090 GN=Col1a2 PE=1 SV=2
18	Q2LDA1	1113	1491	0.635	0.638	Q2LDA1_DANRE Collagen alpha-1(II) chain precursor OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
19	Q3U962	2058	1497	0.948	0.949	CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus OX=10090 GN=Col5a2 PE=1 SV=1
20	Q6IQX2	878	1352	0.506	0.561	Q6IQX2_DANRE Collagen alpha-2(I) chain precursor OS=Danio rerio OX=7955 GN=alpha2(I) PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14828 Amnionless	2.9e+02	11.6	Amnionless
2	PF01410 COLFI	3.3e-105	362.1	Fibrillar collagen C-terminal domain
3	PF01391 Collagen	7e-164	543.1	Collagen triple helix repeat (20 copies)
4	PF12714 TILa	17	16.8	TILa domain
5	PF00093 VWC	8.3e-10	50.2	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364000

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297268	0.993	Collagen alpha-2(I) chain
2	9606.ENSP00000225964	0.983	Collagen alpha-1(I) chain
3	9606.ENSP00000304408	0.983	Collagen alpha-1(III) chain
4	9606.ENSP00000251582	0.982	A disintegrin and metalloproteinase with thrombospondin motifs 2
5	9606.ENSP00000360882	0.979	Collagen alpha-1(V) chain
6	9606.ENSP00000223061	0.959	Procollagen C-endopeptidase enhancer 1
7	9606.ENSP00000305714	0.950	Bone morphogenetic protein 1
8	9606.ENSP00000362304	0.947	A disintegrin and metalloproteinase with thrombospondin motifs 14
9	9606.ENSP00000379350	0.943	Integrin beta-1
10	9606.ENSP00000266718	0.941	Lumican
11	9606.ENSP00000295992	0.940	Procollagen C-endopeptidase enhancer 2
12	9606.ENSP00000261023	0.939	Integrin alpha-V
13	9606.ENSP00000282588	0.939	Integrin alpha-1
14	9606.ENSP00000452786	0.937	Integrin beta-3
15	9606.ENSP00000061240	0.931	Tolloid-like protein 1
16	9606.ENSP00000384999	0.931	Prolyl 4-hydroxylase subunit alpha-2
17	9606.ENSP00000286657	0.930	A disintegrin and metalloproteinase with thrombospondin motifs 3
18	9606.ENSP00000263556	0.926	Prolyl 4-hydroxylase subunit alpha-1
19	9606.ENSP00000401749	0.926	Prolyl 4-hydroxylase subunit alpha-3
20	9606.ENSP00000350630	0.916	Tolloid-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	1.000	extracellular matrix structural constituent
GO:0030020	0.940	extracellular matrix structural constituent conferring tensile strength

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.979	multicellular organismal process
GO:0009987	0.978	cellular process
GO:0032502	0.879	developmental process
GO:0048856	0.864	anatomical structure development
GO:0001503	0.758	ossification
GO:0007275	0.753	multicellular organism development
GO:0065007	0.719	biological regulation
GO:0050789	0.710	regulation of biological process
GO:0048731	0.583	system development
GO:0071840	0.574	cellular component organization or biogenesis
GO:0016043	0.525	cellular component organization
GO:0050896	0.517	response to stimulus
GO:0050794	0.497	regulation of cellular process
GO:0009653	0.495	anatomical structure morphogenesis
GO:0048513	0.465	animal organ development
GO:0030198	0.420	extracellular matrix organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005576	0.999	extracellular region
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0005583	0.977	fibrillar collagen trimer
GO:0005622	0.959	intracellular anatomical structure
GO:0005737	0.942	cytoplasm
GO:0043229	0.885	intracellular organelle
GO:0005615	0.871	extracellular space
GO:0012505	0.842	endomembrane system
GO:0043227	0.821	membrane-bounded organelle
GO:0043233	0.798	organelle lumen
GO:0070013	0.785	intracellular organelle lumen
GO:0043231	0.780	intracellular membrane-bounded organelle
GO:0005788	0.570	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]