StarFunc result for job id P06126

User Input

>input (327 residues)
MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSN
SSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCE
LHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLS
DTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRG
EQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVKHSSLEGQDIVLYWEHHSSV
GFIILAVIVPLLLLIGLALWFRKRCFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06126	1.000	1.000	1.212E-62	327	1.000	1.000	P06126.pdb.gz	CD1A_HUMAN T-cell surface glycoprotein CD1a OS=Homo sapiens OX=9606 GN=CD1A PE=1 SV=4
2	AFDB:P29016	0.825	0.810	3.476E-43	333	0.606	0.595	P29016.pdb.gz	CD1B_HUMAN T-cell surface glycoprotein CD1b OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
3	AFDB:P15812	0.842	0.716	1.268E-42	388	0.535	0.451	P15812.pdb.gz	CD1E_HUMAN T-cell surface glycoprotein CD1e, membrane-associated OS=Homo sapiens OX=9606 GN=CD1E PE=1 SV=2
4	AFDB:P29017	0.853	0.838	1.096E-41	333	0.584	0.574	P29017.pdb.gz	CD1C_HUMAN T-cell surface glycoprotein CD1c OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=2
5	AFDB:P15813	0.837	0.817	1.403E-39	335	0.498	0.487	P15813.pdb.gz	CD1D_HUMAN Antigen-presenting glycoprotein CD1d OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
6	AFDB:P11609	0.851	0.830	9.553E-37	336	0.446	0.435	P11609.pdb.gz	CD1D1_MOUSE Antigen-presenting glycoprotein CD1d1 OS=Mus musculus OX=10090 GN=Cd1d1 PE=1 SV=3
7	PDB:3ov6A	0.795	0.694	2.466E-36	376	0.532	0.463	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
8	PDB:3s6cA	0.787	0.694	3.597E-36	372	0.495	0.435	3s6cA.pdb.gz
9	PDB:1cd1A	0.790	0.941	3.494E-31	273	0.434	0.520	1cd1A.pdb.gz
10	AFDB:A0ZXM3	0.744	0.689	1.904E-23	357	0.223	0.204	A0ZXM3.pdb.gz	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
11	AFDB:U3PTD3	0.714	0.682	1.191E-22	344	0.229	0.218	U3PTD3.pdb.gz	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
12	AFDB:Q8HWB0	0.691	0.666	1.400E-22	341	0.263	0.252	Q8HWB0.pdb.gz	HMR1_MOUSE Major histocompatibility complex class I-related gene protein OS=Mus musculus OX=10090 GN=Mr1 PE=1 SV=2
13	AFDB:Q95460	0.658	0.634	1.646E-22	341	0.278	0.267	Q95460.pdb.gz	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
14	PDB:5j6hA	0.651	0.757	5.440E-20	275	0.214	0.255	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
15	PDB:6d7gA	0.631	0.547	1.781E-19	386	0.190	0.161	6d7gA.pdb.gz
16	PDB:3es6A	0.672	0.780	1.984E-19	277	0.205	0.242	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
17	PDB:6fgbA	0.696	0.846	2.094E-19	265	0.193	0.238	6fgbA.pdb.gz
18	PDB:6e1iA	0.626	0.540	5.832E-19	389	0.199	0.167	6e1iA.pdb.gz
19	PDB:6mp0A	0.613	0.529	2.639E-18	388	0.202	0.170	6mp0A.pdb.gz
20	PDB:3nwmA	0.645	0.560	3.455E-18	384	0.171	0.146	3nwmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06126	0.0	676	327	1.000	1.000	CD1A_HUMAN T-cell surface glycoprotein CD1a OS=Homo sapiens OX=9606 GN=CD1A PE=1 SV=4
2	P29016	3.62e-132	381	333	0.578	0.568	CD1B_HUMAN T-cell surface glycoprotein CD1b OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
3	P29017	3.26e-129	374	333	0.563	0.553	CD1C_HUMAN T-cell surface glycoprotein CD1c OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=2
4	P15812	2.31e-116	343	388	0.517	0.436	CD1E_HUMAN T-cell surface glycoprotein CD1e, membrane-associated OS=Homo sapiens OX=9606 GN=CD1E PE=1 SV=2
5	P15813	2.28e-112	331	335	0.498	0.487	CD1D_HUMAN Antigen-presenting glycoprotein CD1d OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
6	P11609	4.85e-102	305	336	0.474	0.461	CD1D1_MOUSE Antigen-presenting glycoprotein CD1d1 OS=Mus musculus OX=10090 GN=Cd1d1 PE=1 SV=3
7	P11610	8.08e-96	289	336	0.465	0.452	CD1D2_MOUSE Antigen-presenting glycoprotein CD1d2 OS=Mus musculus OX=10090 GN=Cd1d2 PE=1 SV=2
8	H0Y6Y6	3.91e-94	283	281	0.419	0.488	H0Y6Y6_HUMAN CD1c molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=1
9	H7C0I2	2.42e-83	254	246	0.388	0.516	H7C0I2_HUMAN CD1b molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
10	A0A669KB34	6.88e-42	147	242	0.214	0.289	A0A669KB34_HUMAN CD1d molecule OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
11	Q95460	1.52e-25	106	341	0.287	0.276	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
12	P04439	1.92e-20	92.8	365	0.205	0.184	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
13	P25311	7.05e-19	87.4	298	0.232	0.255	ZA2G_HUMAN Zinc-alpha-2-glycoprotein OS=Homo sapiens OX=9606 GN=AZGP1 PE=1 SV=2
14	Q8HWB0	1.46e-18	87.0	341	0.229	0.220	HMR1_MOUSE Major histocompatibility complex class I-related gene protein OS=Mus musculus OX=10090 GN=Mr1 PE=1 SV=2
15	Q5SUL5	5.46e-18	85.9	365	0.235	0.211	Q5SUL5_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1
16	Q95476	6.75e-18	85.5	355	0.177	0.163	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
17	A0ZXM3	3.49e-17	83.6	357	0.165	0.151	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
18	Q8MHM0	3.79e-17	83.2	336	0.232	0.226	Q8MHM0_MOUSE Histocompatibility 2, M region locus 3 OS=Mus musculus OX=10090 GN=H2-M3 PE=2 SV=1
19	Q31093	5.36e-17	82.8	336	0.232	0.226	Q31093_MOUSE Histocompatibility 2, M region locus 3 OS=Mus musculus OX=10090 GN=H2-M3 PE=1 SV=1
20	O46789	6.29e-17	82.8	355	0.177	0.163	O46789_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=B-FIV PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	6.8e-08	44.1	Immunoglobulin C1-set domain
2	PF00047 ig	4.1e+02	12.6	Immunoglobulin domain
3	PF13927 Ig_3	52	15.8	Immunoglobulin domain
4	PF00129 MHC_I	1.5e-06	39.4	Class I Histocompatibility antigen, domains alpha 1 and 2
5	PF16497 MHC_I_3	1.1e-73	258.5	MHC-I family domain
6	PF07686 V-set	1.4e+02	14.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289429

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452780	0.994	Beta-2-microglobulin
2	9606.ENSP00000368450	0.871	CD83 antigen
3	9606.ENSP00000386378	0.867	C-type lectin domain family 4 member K
4	9606.ENSP00000250092	0.862	Macrosialin
5	9606.ENSP00000332049	0.831	T-lymphocyte activation antigen CD86
6	9606.ENSP00000357150	0.815	T-cell surface glycoprotein CD1b
7	9606.ENSP00000357152	0.808	T-cell surface glycoprotein CD1c
8	9606.ENSP00000264246	0.780	T-lymphocyte activation antigen CD80
9	9606.ENSP00000011653	0.776	T-cell surface glycoprotein CD4
10	9606.ENSP00000358490	0.760	T-cell surface antigen CD2
11	9606.ENSP00000354566	0.742	T-cell surface glycoprotein CD3 epsilon chain
12	9606.ENSP00000296871	0.739	Granulocyte-macrophage colony-stimulating factor
13	9606.ENSP00000310036	0.738	Hematopoietic progenitor cell antigen CD34
14	9606.ENSP00000386559	0.738	T-cell surface glycoprotein CD8 alpha chain
15	9606.ENSP00000303769	0.730	AT-hook-containing transcription factor
16	9606.ENSP00000342681	0.727	T-cell surface glycoprotein CD5
17	9606.ENSP00000300692	0.722	T-cell surface glycoprotein CD3 delta chain
18	9606.ENSP00000312027	0.722	T-cell antigen CD7
19	9606.ENSP00000454623	0.715	Integrin alpha-X
20	9606.ENSP00000361359	0.714	Tumor necrosis factor receptor superfamily member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.972	antigen binding
GO:0005102	0.818	signaling receptor binding
GO:0008289	0.693	lipid binding
GO:0038023	0.521	signaling receptor activity
GO:0033218	0.406	amide binding
GO:0042277	0.394	peptide binding
GO:0044877	0.387	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.993	response to stimulus
GO:0002376	0.990	immune system process
GO:0001775	0.986	cell activation
GO:0050789	0.985	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0048518	0.972	positive regulation of biological process
GO:0046649	0.968	lymphocyte activation
GO:0048522	0.925	positive regulation of cellular process
GO:0042110	0.865	T cell activation
GO:0048583	0.801	regulation of response to stimulus
GO:0002252	0.794	immune effector process
GO:0002682	0.755	regulation of immune system process
GO:0002684	0.753	positive regulation of immune system process
GO:0050776	0.708	regulation of immune response
GO:0048584	0.706	positive regulation of response to stimulus
GO:0006955	0.624	immune response
GO:0019222	0.560	regulation of metabolic process
GO:0032502	0.554	developmental process
GO:0048856	0.515	anatomical structure development
GO:0051239	0.502	regulation of multicellular organismal process
GO:0009893	0.486	positive regulation of metabolic process
GO:0060255	0.475	regulation of macromolecule metabolic process
GO:0051240	0.460	positive regulation of multicellular organismal process
GO:0010604	0.444	positive regulation of macromolecule metabolic process
GO:0009605	0.443	response to external stimulus
GO:0002694	0.429	regulation of leukocyte activation
GO:0044419	0.392	biological process involved in interspecies interaction between organisms
GO:0042127	0.391	regulation of cell population proliferation
GO:0010468	0.383	regulation of gene expression
GO:0006950	0.377	response to stress
GO:0051716	0.374	cellular response to stimulus
GO:0006952	0.344	defense response
GO:0010628	0.340	positive regulation of gene expression
GO:0051707	0.323	response to other organism
GO:0051249	0.316	regulation of lymphocyte activation
GO:0042221	0.306	response to chemical
GO:0022407	0.305	regulation of cell-cell adhesion
GO:0002696	0.303	positive regulation of leukocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0012505	0.992	endomembrane system
GO:0005622	0.978	intracellular anatomical structure
GO:0005737	0.969	cytoplasm
GO:0043227	0.925	membrane-bounded organelle
GO:0043229	0.855	intracellular organelle
GO:0043231	0.842	intracellular membrane-bounded organelle
GO:0009986	0.836	cell surface
GO:0005829	0.436	cytosol
GO:0009897	0.330	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]