StarFunc result for job id P06127

User Input

>input (495 residues)
MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVC
SQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHS
RNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGS
LGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQ
NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAAL
CDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYC
KKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP
TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPD
NSSDSDYDLHGAQRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06127	1.000	1.000	2.231E-96	495	1.000	1.000	P06127.pdb.gz	CD5_HUMAN T-cell surface glycoprotein CD5 OS=Homo sapiens OX=9606 GN=CD5 PE=1 SV=2
2	AFDB:P13379	0.434	0.435	3.423E-62	494	0.632	0.634	P13379.pdb.gz	CD5_MOUSE T-cell surface glycoprotein CD5 OS=Mus musculus OX=10090 GN=Cd5 PE=1 SV=1
3	AFDB:P51882	0.512	0.515	2.752E-59	491	0.622	0.627	P51882.pdb.gz	CD5_RAT T-cell surface glycoprotein CD5 OS=Rattus norvegicus OX=10116 GN=Cd5 PE=2 SV=1
4	AFDB:Q5FVU4	0.181	0.156	1.082E-17	597	0.210	0.174	Q5FVU4.pdb.gz	Q5FVU4_RAT Cd6 molecule OS=Rattus norvegicus OX=10116 GN=Cd6 PE=2 SV=1
5	AFDB:A1L4H1	0.192	0.077	6.696E-16	1573	0.204	0.064	A1L4H1.pdb.gz	SRCRL_HUMAN Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3
6	PDB:2xrcC	0.156	0.168	1.974E-3	454	0.048	0.053	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
7	AFDB:P98153	0.099	0.092	7.939E-3	550	0.123	0.111	P98153.pdb.gz	IDD_HUMAN Integral membrane protein DGCR2/IDD OS=Homo sapiens OX=9606 GN=DGCR2 PE=1 SV=1
8	PDB:2xrcB	0.155	0.158	8.891E-3	485	0.040	0.041	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
9	AFDB:Q9JMH2	0.106	0.088	1.466E-2	623	0.117	0.093	Q9JMH2.pdb.gz	LRIT1_RAT Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Lrit1 PE=1 SV=2
10	AFDB:P21758	0.148	0.160	1.937E-2	453	0.083	0.091	P21758.pdb.gz	MSRE_BOVIN Macrophage scavenger receptor types I and II OS=Bos taurus OX=9913 GN=MSR1 PE=1 SV=1
11	AFDB:Q12215	0.098	0.090	3.199E-2	556	0.147	0.131	Q12215.pdb.gz	WSC3_YEAST Cell wall integrity and stress response component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=WSC3 PE=1 SV=1
12	AFDB:F1QNH9	0.112	0.087	4.726E-2	712	0.152	0.105	F1QNH9.pdb.gz
13	PDB:3j6bP	0.113	0.229	2.666E-1	207	0.038	0.092	3j6bP.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
14	PDB:6hivAX	0.088	0.202	1.501	168	0.022	0.065	6hivAX.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:3ihgA	0.056	0.052	1.587	535	0.030	0.028	3ihgA.pdb.gz	Structural basis for substrate recognition and specificity in aklavinone-11-hydroxylase from rhodomycin biosynthesis.
16	PDB:6eu1K	0.085	0.247	1.678	104	0.030	0.144	6eu1K.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
17	PDB:6zm5U	0.103	0.297	2.345	133	0.028	0.105	6zm5U.pdb.gz	Mechanism of membrane-tethered mitochondrial protein synthesis.
18	PDB:7nsbg	0.056	0.061	2.345	429	0.089	0.103	7nsbg.pdb.gz
19	PDB:2g3aA	0.066	0.143	2.479	137	0.040	0.146	2g3aA.pdb.gz
20	PDB:2hzqA	0.070	0.155	2.479	166	0.024	0.072	2hzqA.pdb.gz	Structural insight into the dual ligand specificity and mode of high density lipoprotein association of apolipoprotein d.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06127	0.0	1023	495	1.000	1.000	CD5_HUMAN T-cell surface glycoprotein CD5 OS=Homo sapiens OX=9606 GN=CD5 PE=1 SV=2
2	P13379	0.0	563	494	0.634	0.636	CD5_MOUSE T-cell surface glycoprotein CD5 OS=Mus musculus OX=10090 GN=Cd5 PE=1 SV=1
3	P51882	0.0	559	491	0.622	0.627	CD5_RAT T-cell surface glycoprotein CD5 OS=Rattus norvegicus OX=10116 GN=Cd5 PE=2 SV=1
4	Q9UGM3	1.86e-13	75.9	2413	0.176	0.036	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
5	A0A0G2JVY2	6.63e-13	73.9	1151	0.176	0.076	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
6	D3Z9U2	6.79e-13	73.6	1110	0.176	0.078	D3Z9U2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=4 SV=2
7	A0A8I5ZQF0	7.15e-13	73.6	1109	0.176	0.078	A0A8I5ZQF0_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=1
8	B3F5L5	1.91e-11	68.9	996	0.170	0.084	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
9	B3F5L4	2.62e-11	68.6	1112	0.170	0.076	B3F5L4_MOUSE SCART2 splice variant A OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
10	Q60997	3.68e-11	68.6	2085	0.188	0.045	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
11	Q86VB7	9.59e-10	63.5	1156	0.164	0.070	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
12	Q61003	5.53e-09	60.8	665	0.172	0.128	CD6_MOUSE T-cell differentiation antigen CD6 OS=Mus musculus OX=10090 GN=Cd6 PE=1 SV=2
13	Q5FVU4	5.77e-09	60.8	597	0.182	0.151	Q5FVU4_RAT Cd6 molecule OS=Rattus norvegicus OX=10116 GN=Cd6 PE=2 SV=1
14	Q812A4	7.12e-09	60.5	665	0.182	0.135	Q812A4_RAT CD6 antigen OS=Rattus norvegicus OX=10116 GN=Cd6 PE=2 SV=1
15	G3V8U0	8.11e-09	60.5	665	0.182	0.135	G3V8U0_RAT Cd6 molecule OS=Rattus norvegicus OX=10116 GN=Cd6 PE=4 SV=1
16	Q8CIZ5	1.12e-06	53.9	1418	0.121	0.042	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
17	P30203	1.50e-06	53.1	668	0.172	0.127	CD6_HUMAN T-cell differentiation antigen CD6 OS=Homo sapiens OX=9606 GN=CD6 PE=1 SV=3
18	Q8BIC8	1.76e-06	53.1	991	0.154	0.077	Q8BIC8_MOUSE SRCR domain-containing protein OS=Mus musculus OX=10090 GN=Scart1 PE=2 SV=1
19	A0A1B0GSB0	3.03e-06	52.4	991	0.154	0.077	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
20	Q8CGY7	3.24e-06	52.4	989	0.154	0.077	Q8CGY7_MOUSE Scavenger receptor cysteine-rich type 1 protein CD163c-alpha OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15957 Comm	3.4e+02	13.0	Commissureless
2	PF00530 SRCR	4.2e-13	60.8	Scavenger receptor cysteine-rich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342681

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379980	0.994	B-cell differentiation antigen CD72
2	9606.ENSP00000358490	0.971	T-cell surface antigen CD2
3	9606.ENSP00000337825	0.930	Tyrosine-protein kinase Lck
4	9606.ENSP00000011653	0.909	T-cell surface glycoprotein CD4
5	9606.ENSP00000312027	0.907	T-cell antigen CD7
6	9606.ENSP00000356024	0.895	Complement receptor type 2
7	9606.ENSP00000437940	0.895	B-lymphocyte antigen CD19
8	9606.ENSP00000386559	0.892	T-cell surface glycoprotein CD8 alpha chain
9	9606.ENSP00000411355	0.890	Receptor-type tyrosine-protein phosphatase C
10	9606.ENSP00000221972	0.881	B-cell antigen receptor complex-associated protein alpha chain
11	9606.ENSP00000353238	0.875	Leukosialin
12	9606.ENSP00000418525	0.875	Neprilysin
13	9606.ENSP00000264033	0.872	E3 ubiquitin-protein ligase CBL
14	9606.ENSP00000323280	0.850	T-cell differentiation antigen CD6
15	9606.ENSP00000085219	0.849	B-cell receptor CD22
16	9606.ENSP00000264972	0.847	Tyrosine-protein kinase ZAP-70
17	9606.ENSP00000357156	0.846	CD5 antigen-like
18	9606.ENSP00000226279	0.834	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
19	9606.ENSP00000441691	0.826	Integrin alpha-M
20	9606.ENSP00000228434	0.819	Early activation antigen CD69

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0051716	0.978	cellular response to stimulus
GO:0023052	0.975	signaling
GO:0048518	0.975	positive regulation of biological process
GO:0007165	0.974	signal transduction
GO:0048522	0.934	positive regulation of cellular process
GO:0002376	0.927	immune system process
GO:0002684	0.927	positive regulation of immune system process
GO:0050865	0.925	regulation of cell activation
GO:0002694	0.920	regulation of leukocyte activation
GO:0051240	0.902	positive regulation of multicellular organismal process
GO:0051249	0.876	regulation of lymphocyte activation
GO:0002696	0.871	positive regulation of leukocyte activation
GO:0045785	0.853	positive regulation of cell adhesion
GO:0051251	0.852	positive regulation of lymphocyte activation
GO:0050863	0.843	regulation of T cell activation
GO:1903039	0.839	positive regulation of leukocyte cell-cell adhesion
GO:0008219	0.648	cell death
GO:0032501	0.518	multicellular organismal process
GO:0012501	0.501	programmed cell death
GO:0019222	0.410	regulation of metabolic process
GO:0050870	0.405	positive regulation of T cell activation
GO:0007166	0.398	cell surface receptor signaling pathway
GO:0048583	0.387	regulation of response to stimulus
GO:0060255	0.381	regulation of macromolecule metabolic process
GO:0006915	0.362	apoptotic process
GO:0097190	0.305	apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.564	intracellular anatomical structure
GO:0009986	0.485	cell surface
GO:0043227	0.448	membrane-bounded organelle
GO:0043231	0.405	intracellular membrane-bounded organelle
GO:0005737	0.370	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]