StarFunc result for job id P06213

User Input

>input (1382 residues)
MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAF
PNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSR
EKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSN
PS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6pxvA	0.266	0.433	0.000	823	0.595	0.999	6pxvA.pdb.gz
2	PDB:8dtlA	0.342	0.605	0.000	741	0.525	0.980	8dtlA.pdb.gz
3	PDB:8eyyA	0.348	0.593	0.000	775	0.543	0.969	8eyyA.pdb.gz
4	AFDB:A0A0R4IGP2	0.730	0.707	0.000	1433	0.545	0.525	A0A0R4IGP2.pdb.gz
5	AFDB:B0R0Q2	0.582	0.583	0.000	1380	0.541	0.541	B0R0Q2.pdb.gz
6	AFDB:F1QNX5	0.719	0.733	0.000	1353	0.680	0.695	F1QNX5.pdb.gz
7	AFDB:O73798	0.674	0.684	0.000	1358	0.559	0.568	O73798.pdb.gz	IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1
8	AFDB:P09208	0.527	0.377	0.000	2144	0.369	0.238	P09208.pdb.gz	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
9	AFDB:P14616	0.631	0.668	0.000	1297	0.504	0.537	P14616.pdb.gz	INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens OX=9606 GN=INSRR PE=1 SV=2
10	AFDB:P15127	0.822	0.821	0.000	1383	0.945	0.944	P15127.pdb.gz	INSR_RAT Insulin receptor OS=Rattus norvegicus OX=10116 GN=Insr PE=1 SV=1
11	AFDB:Q1LVG4	0.675	0.688	0.000	1348	0.653	0.670	Q1LVG4.pdb.gz	Q1LVG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRb PE=1 SV=3
12	AFDB:Q60751	0.812	0.817	0.000	1373	0.571	0.575	Q60751.pdb.gz	IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus OX=10090 GN=Igf1r PE=1 SV=3
13	AFDB:Q64716	0.606	0.638	0.000	1300	0.498	0.529	Q64716.pdb.gz	INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus OX=10116 GN=Insrr PE=1 SV=3
14	PDB:7bwaA	0.236	0.400	4.478E-101	674	0.487	0.999	7bwaA.pdb.gz
15	PDB:6pyhD	0.257	0.431	6.090E-93	798	0.325	0.563	6pyhD.pdb.gz
16	PDB:2h8hA	0.177	0.516	3.275E-25	445	0.085	0.265	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
17	PDB:1k9aB	0.171	0.522	3.702E-22	441	0.074	0.231	1k9aB.pdb.gz
18	PDB:4fl2A	0.179	0.431	1.140E-21	555	0.068	0.169	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
19	PDB:7mn8B	0.173	0.369	8.162E-21	579	0.093	0.223	7mn8B.pdb.gz
20	PDB:4k2rA	0.172	0.419	1.800E-19	551	0.058	0.145	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0C4UQS4	1067	1454	0.434	0.413	A0A0C4UQS4_NILLU Tyrosine-protein kinase receptor OS=Nilaparvata lugens OX=108931 PE=1 SV=1
2	A0A0C4UR07	799	1427	0.371	0.359	A0A0C4UR07_NILLU Tyrosine-protein kinase receptor OS=Nilaparvata lugens OX=108931 PE=1 SV=1
3	B7SNG4	1940	1353	0.682	0.696	B7SNG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRa PE=1 SV=1
4	G1K218	1543	1367	0.569	0.575	G1K218_BOVIN Tyrosine-protein kinase receptor OS=Bos taurus OX=9913 GN=IGF1R PE=3 SV=3
5	I3PGL2	622	477	0.227	0.658	I3PGL2_BOVIN Tyrosine-protein kinase receptor (Fragment) OS=Bos taurus OX=9913 GN=IGFR1 PE=2 SV=1
6	O73798	1534	1358	0.564	0.574	IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1
7	P06213	2884	1382	1.000	1.000	INSR_HUMAN Insulin receptor OS=Homo sapiens OX=9606 GN=INSR PE=1 SV=4
8	P08069	1543	1367	0.570	0.576	IGF1R_HUMAN Insulin-like growth factor 1 receptor OS=Homo sapiens OX=9606 GN=IGF1R PE=1 SV=1
9	P09208	801	2144	0.382	0.246	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
10	P14616	1368	1297	0.501	0.534	INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens OX=9606 GN=INSRR PE=1 SV=2
11	P15127	2709	1383	0.946	0.945	INSR_RAT Insulin receptor OS=Rattus norvegicus OX=10116 GN=Insr PE=1 SV=1
12	P15208	2680	1372	0.936	0.942	INSR_MOUSE Insulin receptor OS=Mus musculus OX=10090 GN=Insr PE=1 SV=2
13	P24062	1535	1370	0.567	0.572	IGF1R_RAT Insulin-like growth factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Igf1r PE=2 SV=2
14	Q05688	731	640	0.279	0.602	IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus OX=9913 GN=IGF1R PE=2 SV=1
15	Q1LVG4	1860	1348	0.656	0.672	Q1LVG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRb PE=1 SV=3
16	Q60751	1524	1373	0.566	0.570	IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus OX=10090 GN=Igf1r PE=1 SV=3
17	Q64716	1365	1300	0.499	0.530	INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus OX=10116 GN=Insrr PE=1 SV=3
18	Q968Y9	593	1846	0.326	0.244	INSR_CAEEL Insulin-like receptor OS=Caenorhabditis elegans OX=6239 GN=daf-2 PE=1 SV=2
19	Q9PVZ4	2001	1362	0.699	0.709	INSR_XENLA Insulin receptor OS=Xenopus laevis OX=8355 GN=insr PE=1 SV=1
20	Q9PWN6	1711	989	0.603	0.843	Q9PWN6_CHICK Tyrosine-protein kinase receptor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11473 B2	2.8e+02	12.7	RNA binding protein B2
2	PF14771 DUF4476	5.1e+02	12.4	Domain of unknown function (DUF4476)
3	PF00041 fn3	1.6e-14	65.3	Fibronectin type III domain
4	PF00757 Furin-like	5.7e-33	125.4	Furin-like cysteine rich region
5	PF17870 Insulin_TMD	1.5e-17	74.7	Insulin receptor trans-membrane segment
6	PF14531 Kinase-like	10	17.0	Kinase-like
7	PF00069 Pkinase	1.4e-37	141.1	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	1.4e-91	318.0	Protein tyrosine and serine/threonine kinase
9	PF01030 Recep_L_domain	1.6e-52	187.6	Receptor L domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303830

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302665	0.999	Insulin-like growth factor I
2	9606.ENSP00000304895	0.999	Insulin receptor substrate 1
3	9606.ENSP00000360683	0.999	Tyrosine-protein phosphatase non-receptor type 1
4	9606.ENSP00000380432	0.999	Insulin
5	9606.ENSP00000263915	0.998	Growth factor receptor-bound protein 14
6	9606.ENSP00000440273	0.997	SH2B adapter protein 2
7	9606.ENSP00000401303	0.995	SHC-transforming protein 1
8	9606.ENSP00000428056	0.995	Phosphatidylinositol 3-kinase regulatory subunit alpha
9	9606.ENSP00000381793	0.993	Growth factor receptor-bound protein 10
10	9606.ENSP00000340944	0.988	Tyrosine-protein phosphatase non-receptor type 11
11	9606.ENSP00000365016	0.982	Insulin receptor substrate 2
12	9606.ENSP00000268035	0.971	Insulin-like growth factor 1 receptor
13	9606.ENSP00000376345	0.970	Growth factor receptor-bound protein 2
14	9606.ENSP00000339191	0.966	Caveolin-1
15	9606.ENSP00000330341	0.964	Suppressor of cytokine signaling 3
16	9606.ENSP00000360293	0.964	Sorbin and SH3 domain-containing protein 1
17	9606.ENSP00000311857	0.961	Tyrosine-protein phosphatase non-receptor type 2
18	9606.ENSP00000391826	0.959	Insulin-like growth factor II
19	9606.ENSP00000263967	0.958	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
20	9606.ENSP00000284601	0.954	Protein phosphatase 1 regulatory subunit 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0004714	0.995	transmembrane receptor protein tyrosine kinase activity
GO:0042562	0.986	hormone binding
GO:0033218	0.986	amide binding
GO:0016500	0.986	protein-hormone receptor activity
GO:0017046	0.961	peptide hormone binding
GO:0019904	0.944	protein domain specific binding
GO:0044877	0.932	protein-containing complex binding
GO:0098772	0.911	molecular function regulator activity
GO:0030234	0.874	enzyme regulator activity
GO:0019838	0.871	growth factor binding
GO:0005520	0.804	insulin-like growth factor binding
GO:0097159	0.658	organic cyclic compound binding
GO:1901363	0.611	heterocyclic compound binding
GO:0043559	0.523	insulin binding
GO:0043168	0.512	anion binding
GO:0005102	0.506	signaling receptor binding
GO:0042802	0.489	identical protein binding
GO:0005009	0.434	insulin receptor activity
GO:0036094	0.431	small molecule binding
GO:0019899	0.410	enzyme binding
GO:0019887	0.406	protein kinase regulator activity
GO:0030296	0.372	protein tyrosine kinase activator activity
GO:0043560	0.364	insulin receptor substrate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051716	0.995	cellular response to stimulus
GO:0007165	0.994	signal transduction
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0071375	0.985	cellular response to peptide hormone stimulus
GO:0032868	0.982	response to insulin
GO:0007166	0.981	cell surface receptor signaling pathway
GO:0019222	0.980	regulation of metabolic process
GO:0032502	0.977	developmental process
GO:0006468	0.976	protein phosphorylation
GO:0008286	0.970	insulin receptor signaling pathway
GO:0046777	0.969	protein autophosphorylation
GO:0048856	0.959	anatomical structure development
GO:0010675	0.959	regulation of cellular carbohydrate metabolic process
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0048518	0.945	positive regulation of biological process
GO:0051171	0.933	regulation of nitrogen compound metabolic process
GO:0018193	0.912	peptidyl-amino acid modification
GO:0032501	0.904	multicellular organismal process
GO:0018212	0.901	peptidyl-tyrosine modification
GO:0051174	0.885	regulation of phosphorus metabolic process
GO:0043255	0.878	regulation of carbohydrate biosynthetic process
GO:0043467	0.859	regulation of generation of precursor metabolites and energy
GO:0062012	0.849	regulation of small molecule metabolic process
GO:0048522	0.835	positive regulation of cellular process
GO:0050790	0.801	regulation of catalytic activity
GO:0048519	0.796	negative regulation of biological process
GO:0010556	0.795	regulation of macromolecule biosynthetic process
GO:0031326	0.791	regulation of cellular biosynthetic process
GO:0019219	0.791	regulation of nucleobase-containing compound metabolic process
GO:0051246	0.789	regulation of protein metabolic process
GO:0032881	0.781	regulation of polysaccharide metabolic process
GO:0051247	0.780	positive regulation of protein metabolic process
GO:0010676	0.756	positive regulation of cellular carbohydrate metabolic process
GO:0048523	0.755	negative regulation of cellular process
GO:0042327	0.720	positive regulation of phosphorylation
GO:0001932	0.718	regulation of protein phosphorylation
GO:0051239	0.716	regulation of multicellular organismal process
GO:0010906	0.715	regulation of glucose metabolic process
GO:0018108	0.685	peptidyl-tyrosine phosphorylation
GO:0048583	0.673	regulation of response to stimulus
GO:0023051	0.670	regulation of signaling
GO:0010646	0.669	regulation of cell communication
GO:0070873	0.621	regulation of glycogen metabolic process
GO:0051128	0.606	regulation of cellular component organization
GO:0032885	0.588	regulation of polysaccharide biosynthetic process
GO:0007275	0.569	multicellular organism development
GO:0009966	0.558	regulation of signal transduction
GO:0005979	0.555	regulation of glycogen biosynthetic process
GO:0051130	0.548	positive regulation of cellular component organization
GO:0042592	0.543	homeostatic process
GO:0010468	0.442	regulation of gene expression
GO:0048584	0.412	positive regulation of response to stimulus
GO:0042593	0.399	glucose homeostasis
GO:0048513	0.394	animal organ development
GO:0032879	0.388	regulation of localization
GO:0048731	0.358	system development
GO:1902531	0.346	regulation of intracellular signal transduction
GO:0042127	0.313	regulation of cell population proliferation
GO:0009892	0.307	negative regulation of metabolic process
GO:0071840	0.305	cellular component organization or biogenesis
GO:0090068	0.302	positive regulation of cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.955	membrane-bounded organelle
GO:0005829	0.919	cytosol
GO:0043231	0.884	intracellular membrane-bounded organelle
GO:0005634	0.618	nucleus
GO:0098590	0.598	plasma membrane region
GO:0012505	0.587	endomembrane system
GO:0032991	0.548	protein-containing complex
GO:0031982	0.386	vesicle
GO:0005576	0.369	extracellular region
GO:0045121	0.367	membrane raft
GO:0005615	0.328	extracellular space
GO:0044853	0.316	plasma membrane raft
GO:0005901	0.310	caveola
GO:0070013	0.307	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.995	receptor protein-tyrosine kinase.

[back to server]