StarFunc result for job id P06239

User Input

>input (509 residues)
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06239	1.000	1.000	2.019E-102	509	1.000	1.000	P06239.pdb.gz	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
2	AFDB:P08103	0.855	0.831	2.355E-76	524	0.642	0.624	P08103.pdb.gz	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
3	AFDB:P07948	0.860	0.855	2.630E-76	512	0.640	0.637	P07948.pdb.gz	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
4	AFDB:W5U6C9	0.857	0.872	2.937E-76	500	0.701	0.714	W5U6C9.pdb.gz	W5U6C9_ICTPU Tyrosine-protein kinase OS=Ictalurus punctatus OX=7998 GN=LCK PE=2 SV=1
5	AFDB:Q5ZMB9	0.862	0.891	4.568E-76	492	0.631	0.652	Q5ZMB9.pdb.gz	Q5ZMB9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=LYN PE=1 SV=1
6	AFDB:J3KPD6	0.840	0.814	4.827E-76	526	0.660	0.639	J3KPD6.pdb.gz	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
7	AFDB:Q66I04	0.865	0.863	1.505E-73	510	0.617	0.616	Q66I04.pdb.gz	Q66I04_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:92124 PE=2 SV=1
8	AFDB:P51451	0.862	0.869	1.877E-73	505	0.605	0.610	P51451.pdb.gz	BLK_HUMAN Tyrosine-protein kinase Blk OS=Homo sapiens OX=9606 GN=BLK PE=1 SV=3
9	AFDB:P16277	0.854	0.870	5.157E-72	499	0.601	0.613	P16277.pdb.gz	BLK_MOUSE Tyrosine-protein kinase Blk OS=Mus musculus OX=10090 GN=Blk PE=1 SV=4
10	AFDB:A1A5H8	0.840	0.786	1.340E-70	546	0.568	0.529	A1A5H8.pdb.gz	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
11	PDB:2h8hA	0.814	0.926	8.292E-63	445	0.528	0.604	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.500	0.572	2.628E-39	441	0.350	0.404	1k9aB.pdb.gz
13	PDB:4fl2A	0.490	0.452	1.928E-31	555	0.281	0.258	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.479	0.445	1.455E-28	551	0.251	0.232	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:7mfdA	0.441	0.539	6.939E-17	410	0.189	0.234	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
16	PDB:6s73A	0.442	0.806	9.665E-17	269	0.138	0.260	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:8dksA	0.391	0.675	1.205E-16	283	0.155	0.279	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
18	PDB:4btfA	0.439	0.533	5.978E-16	413	0.134	0.165	4btfA.pdb.gz
19	PDB:4krcA	0.419	0.689	2.377E-15	297	0.138	0.236	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
20	PDB:6uanB	0.405	0.757	3.499E-15	261	0.157	0.307	6uanB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1A5H8	600	546	0.554	0.516	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
2	E1BIM8	577	688	0.534	0.395	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
3	F1LM93	587	541	0.542	0.510	YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus OX=10116 GN=Yes1 PE=1 SV=1
4	F1NQU9	575	534	0.540	0.515	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
5	F1RDG9	593	544	0.570	0.533	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
6	H0Y3C5	696	525	0.637	0.617	H0Y3C5_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
7	J3KPD6	696	526	0.637	0.616	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
8	J3QRU1	589	548	0.544	0.505	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
9	P00523	578	533	0.532	0.508	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
10	P05480	575	535	0.532	0.507	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
11	P06239	1065	509	1.000	1.000	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
12	P06240	1030	509	0.969	0.969	LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus OX=10090 GN=Lck PE=1 SV=4
13	P06241	593	537	0.554	0.525	FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3
14	P07947	589	543	0.544	0.510	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
15	P07948	685	512	0.635	0.631	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
16	P08103	689	524	0.625	0.607	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
17	P08631	696	526	0.637	0.616	HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=5
18	P09324	592	541	0.546	0.514	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
19	P09769	560	529	0.528	0.509	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
20	P12931	576	536	0.534	0.507	SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	5.9	17.5	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	41	14.6	Haspin like kinase domain
3	PF06293 Kdo	1.7e+02	13.0	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	2.4e-44	163.3	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	2.4e-91	317.2	Protein tyrosine and serine/threonine kinase
6	PF00017 SH2	1.8e-21	87.3	SH2 domain
7	PF00018 SH3_1	4.7e-10	50.2	SH3 domain
8	PF18348 SH3_16	4.7e+02	12.0	Bacterial dipeptidyl-peptidase Sh3 domain
9	PF07653 SH3_2	0.00026	32.1	Variant SH3 domain
10	PF14604 SH3_9	0.0054	28.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337825

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000011653	0.999	T-cell surface glycoprotein CD4
2	9606.ENSP00000324890	0.999	T-cell-specific surface glycoprotein CD28
3	9606.ENSP00000354782	0.999	T-cell surface glycoprotein CD3 zeta chain
4	9606.ENSP00000386559	0.999	T-cell surface glycoprotein CD8 alpha chain
5	9606.ENSP00000411355	0.999	Receptor-type tyrosine-protein phosphatase C
6	9606.ENSP00000046794	0.998	Lymphocyte cytosolic protein 2
7	9606.ENSP00000264033	0.998	E3 ubiquitin-protein ligase CBL
8	9606.ENSP00000303939	0.997	Cytotoxic T-lymphocyte protein 4
9	9606.ENSP00000352833	0.996	Tyrosine-protein phosphatase non-receptor type 22
10	9606.ENSP00000264972	0.995	Tyrosine-protein kinase ZAP-70
11	9606.ENSP00000354566	0.993	T-cell surface glycoprotein CD3 epsilon chain
12	9606.ENSP00000376123	0.993	SH2 domain-containing protein 2A
13	9606.ENSP00000378845	0.992	Linker for activation of T cells
14	9606.ENSP00000398632	0.992	CD44 antigen
15	9606.ENSP00000358490	0.991	T-cell surface antigen CD2
16	9606.ENSP00000472929	0.991	Proto-oncogene vav
17	9606.ENSP00000300692	0.988	T-cell surface glycoprotein CD3 delta chain
18	9606.ENSP00000391592	0.988	Tyrosine-protein phosphatase non-receptor type 6
19	9606.ENSP00000264657	0.987	Signal transducer and activator of transcription 3
20	9606.ENSP00000369293	0.987	Interleukin-2 receptor subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004713	0.999	protein tyrosine kinase activity
GO:0005102	0.859	signaling receptor binding
GO:0019900	0.797	kinase binding
GO:0019901	0.772	protein kinase binding
GO:0004715	0.768	non-membrane spanning protein tyrosine kinase activity
GO:0001784	0.745	phosphotyrosine residue binding
GO:0044877	0.363	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0051716	0.984	cellular response to stimulus
GO:0048522	0.983	positive regulation of cellular process
GO:0023052	0.980	signaling
GO:0007154	0.980	cell communication
GO:0007165	0.965	signal transduction
GO:0048583	0.958	regulation of response to stimulus
GO:0071704	0.939	organic substance metabolic process
GO:0032501	0.936	multicellular organismal process
GO:0002682	0.928	regulation of immune system process
GO:0002376	0.927	immune system process
GO:0006468	0.908	protein phosphorylation
GO:0002768	0.880	immune response-regulating cell surface receptor signaling pathway
GO:0001775	0.879	cell activation
GO:0002429	0.854	immune response-activating cell surface receptor signaling pathway
GO:0050851	0.834	antigen receptor-mediated signaling pathway
GO:0019222	0.783	regulation of metabolic process
GO:0060255	0.763	regulation of macromolecule metabolic process
GO:0032502	0.747	developmental process
GO:0042221	0.731	response to chemical
GO:0006950	0.728	response to stress
GO:0018108	0.663	peptidyl-tyrosine phosphorylation
GO:0048856	0.616	anatomical structure development
GO:0051239	0.589	regulation of multicellular organismal process
GO:0080090	0.581	regulation of primary metabolic process
GO:0023051	0.578	regulation of signaling
GO:0031323	0.565	regulation of cellular metabolic process
GO:0048519	0.542	negative regulation of biological process
GO:0051173	0.505	positive regulation of nitrogen compound metabolic process
GO:0010604	0.504	positive regulation of macromolecule metabolic process
GO:0030155	0.487	regulation of cell adhesion
GO:0010646	0.478	regulation of cell communication
GO:0010468	0.458	regulation of gene expression
GO:0009966	0.458	regulation of signal transduction
GO:0065009	0.442	regulation of molecular function
GO:0031325	0.436	positive regulation of cellular metabolic process
GO:0051240	0.429	positive regulation of multicellular organismal process
GO:0048523	0.419	negative regulation of cellular process
GO:0050865	0.412	regulation of cell activation
GO:0002694	0.377	regulation of leukocyte activation
GO:0050867	0.361	positive regulation of cell activation
GO:0070887	0.350	cellular response to chemical stimulus
GO:0051246	0.328	regulation of protein metabolic process
GO:0042325	0.327	regulation of phosphorylation
GO:1902531	0.319	regulation of intracellular signal transduction
GO:0051247	0.317	positive regulation of protein metabolic process
GO:0001932	0.311	regulation of protein phosphorylation
GO:0010033	0.306	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0005829	0.970	cytosol
GO:0043226	0.957	organelle
GO:0043229	0.891	intracellular organelle
GO:0043227	0.817	membrane-bounded organelle
GO:0043231	0.748	intracellular membrane-bounded organelle
GO:0043232	0.353	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.768	non-specific protein-tyrosine kinase.

[back to server]