StarFunc result for job id P06241

User Input

>input (537 residues)
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1RDG9	0.853	0.842	6.509E-94	544	0.918	0.906	F1RDG9.pdb.gz	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
2	AFDB:F1NQU9	0.821	0.826	5.181E-87	534	0.931	0.936	F1NQU9.pdb.gz	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
3	AFDB:A5WWJ6	0.916	0.931	9.158E-85	528	0.773	0.786	A5WWJ6.pdb.gz
4	AFDB:A1A5H8	0.840	0.827	1.524E-79	546	0.745	0.733	A1A5H8.pdb.gz	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
5	AFDB:Q1JPZ3	0.842	0.847	6.548E-77	534	0.695	0.699	Q1JPZ3.pdb.gz	SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio OX=7955 GN=src PE=1 SV=2
6	AFDB:P09769	0.872	0.885	2.419E-76	529	0.706	0.716	P09769.pdb.gz	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
7	AFDB:J3QRU1	0.823	0.807	5.582E-76	548	0.732	0.717	J3QRU1.pdb.gz	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
8	AFDB:P14234	0.851	0.884	6.862E-75	517	0.704	0.731	P14234.pdb.gz	FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus OX=10090 GN=Fgr PE=1 SV=2
9	AFDB:E1BIM8	0.840	0.656	4.275E-74	688	0.695	0.542	E1BIM8.pdb.gz	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
10	PDB:2h8hA	0.812	0.977	6.429E-67	445	0.642	0.775	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
11	AFDB:P08103	0.809	0.829	1.193E-66	524	0.561	0.574	P08103.pdb.gz	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
12	PDB:1k9aB	0.466	0.560	2.083E-37	441	0.315	0.383	1k9aB.pdb.gz
13	PDB:4fl2A	0.456	0.441	7.953E-30	555	0.259	0.250	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.442	0.431	6.383E-26	551	0.240	0.234	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:7mfdA	0.422	0.542	1.967E-16	410	0.182	0.239	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
16	PDB:6s73A	0.424	0.816	2.547E-15	269	0.123	0.245	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:4krcA	0.401	0.692	3.486E-15	297	0.136	0.246	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
18	PDB:8dksA	0.380	0.687	4.770E-15	283	0.147	0.279	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
19	PDB:1unlA	0.388	0.677	5.026E-15	292	0.127	0.233	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:6lk5A	0.410	0.792	1.672E-14	265	0.127	0.257	6lk5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1A5H8	802	546	0.754	0.742	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
2	E1BIM8	763	688	0.687	0.536	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
3	F1LM93	799	541	0.737	0.732	YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus OX=10116 GN=Yes1 PE=1 SV=1
4	F1NQU9	1040	534	0.931	0.936	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
5	F1RDG9	1035	544	0.918	0.906	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
6	H0Y3C5	627	525	0.559	0.571	H0Y3C5_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
7	J3KPD6	627	526	0.561	0.572	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
8	J3QRU1	800	548	0.743	0.728	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
9	O45539	524	507	0.501	0.531	SRC2_CAEEL Tyrosine protein-kinase src-2 OS=Caenorhabditis elegans OX=6239 GN=src-2 PE=1 SV=2
10	P00523	760	533	0.676	0.681	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
11	P05480	760	535	0.700	0.703	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
12	P06239	593	509	0.525	0.554	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
13	P06240	592	509	0.525	0.554	LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus OX=10090 GN=Lck PE=1 SV=4
14	P06241	1124	537	1.000	1.000	FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3
15	P07947	800	543	0.743	0.735	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
16	P07948	590	512	0.523	0.549	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
17	P08103	614	524	0.540	0.553	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
18	P08631	627	526	0.561	0.572	HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=5
19	P09324	808	541	0.743	0.738	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
20	P09769	771	529	0.709	0.720	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1e+02	13.4	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	1.6e+02	12.6	Haspin like kinase domain
3	PF00069 Pkinase	1.1e-43	161.1	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	3.3e-90	313.5	Protein tyrosine and serine/threonine kinase
5	PF00017 SH2	2e-25	100.0	SH2 domain
6	PF00018 SH3_1	3.8e-17	72.9	SH3 domain
7	PF17902 SH3_10	20	16.6	SH3 domain
8	PF07653 SH3_2	8.2e-08	43.3	Variant SH3 domain
9	PF08239 SH3_3	1e+02	14.7	Bacterial SH3 domain
10	PF14604 SH3_9	1.4e-08	45.9	Variant SH3 domain
11	PF17978 zf-RING_14	1.4e+02	14.3	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010369949.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010383478.1	0.995	Cytoplasmic adapter regulating receptors of the signaling lymphocytic activation molecule (SLAM) family such as SLAMF1, CD244, LY9, CD84, SLAMF6 and SLAMF7. In SLAM signaling seems to cooperate with SH2D1B/EAT-2
2	61622.XP_010353661.1	0.994	Proto-oncogene tyrosine-protein kinase Src
3	61622.XP_010353207.1	0.993	YES proto-oncogene 1, Src family tyrosine kinase
4	61622.XP_010355312.1	0.992	E3 ubiquitin-protein ligase CBL
5	61622.XP_010378506.1	0.991	Phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
6	61622.XP_010377011.1	0.990	E3 ubiquitin-protein ligase CBL-B isoform X1
7	61622.XP_010362972.1	0.982	SHC-transforming protein 1 isoform X1
8	61622.XP_010352171.1	0.981	KH domain-containing, RNA-binding, signal transduction-associated protein 1
9	61622.XP_010381093.1	0.981	Catenin delta-1 isoform X1
10	61622.XP_010370100.1	0.980	CD247 molecule
11	61622.XP_010365955.1	0.979	FYN-binding protein isoform X1
12	61622.XP_010372596.1	0.978	Catenin beta-1
13	61622.XP_010368563.1	0.974	Glutamate ionotropic receptor NMDA type subunit 2A
14	61622.XP_010359397.1	0.973	Wiskott-Aldrich syndrome
15	61622.XP_010356540.1	0.971	Protein tyrosine phosphatase, receptor type C
16	61622.XP_010383749.1	0.970	Protein tyrosine kinase 2
17	61622.XP_010368074.1	0.967	Ras homolog family member A
18	61622.XP_010362652.1	0.963	Cell division cycle 42
19	61622.XP_010381274.1	0.962	BCAR1, Cas family scaffolding protein
20	61622.XP_010365433.1	0.961	Fc fragment of IgE receptor Ig

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004713	0.999	protein tyrosine kinase activity
GO:0005102	0.915	signaling receptor binding
GO:0019899	0.866	enzyme binding
GO:0004715	0.723	non-membrane spanning protein tyrosine kinase activity
GO:0044877	0.498	protein-containing complex binding
GO:0051219	0.467	phosphoprotein binding
GO:0019900	0.414	kinase binding
GO:0045309	0.354	protein phosphorylated amino acid binding
GO:0019901	0.333	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0051716	0.974	cellular response to stimulus
GO:0048518	0.961	positive regulation of biological process
GO:0007154	0.915	cell communication
GO:0023052	0.910	signaling
GO:0071704	0.902	organic substance metabolic process
GO:0044238	0.894	primary metabolic process
GO:0007165	0.878	signal transduction
GO:0032501	0.868	multicellular organismal process
GO:0036211	0.866	protein modification process
GO:0044237	0.853	cellular metabolic process
GO:0048522	0.835	positive regulation of cellular process
GO:0042221	0.828	response to chemical
GO:0019222	0.824	regulation of metabolic process
GO:0032502	0.795	developmental process
GO:0048583	0.778	regulation of response to stimulus
GO:0048856	0.726	anatomical structure development
GO:0006796	0.689	phosphate-containing compound metabolic process
GO:0016310	0.648	phosphorylation
GO:0051171	0.603	regulation of nitrogen compound metabolic process
GO:0060255	0.595	regulation of macromolecule metabolic process
GO:0071840	0.570	cellular component organization or biogenesis
GO:0016043	0.524	cellular component organization
GO:0031323	0.497	regulation of cellular metabolic process
GO:0080090	0.490	regulation of primary metabolic process
GO:0006468	0.490	protein phosphorylation
GO:0048523	0.465	negative regulation of cellular process
GO:0007166	0.464	cell surface receptor signaling pathway
GO:0007275	0.457	multicellular organism development
GO:0010604	0.455	positive regulation of macromolecule metabolic process
GO:0002376	0.448	immune system process
GO:0048584	0.448	positive regulation of response to stimulus
GO:0065009	0.435	regulation of molecular function
GO:0023051	0.435	regulation of signaling
GO:0010646	0.435	regulation of cell communication
GO:0051246	0.422	regulation of protein metabolic process
GO:0009966	0.414	regulation of signal transduction
GO:0051173	0.390	positive regulation of nitrogen compound metabolic process
GO:0051239	0.388	regulation of multicellular organismal process
GO:0031325	0.355	positive regulation of cellular metabolic process
GO:0001932	0.345	regulation of protein phosphorylation
GO:0050790	0.331	regulation of catalytic activity
GO:0002682	0.326	regulation of immune system process
GO:0002684	0.320	positive regulation of immune system process
GO:0010468	0.317	regulation of gene expression
GO:0051247	0.311	positive regulation of protein metabolic process
GO:1902531	0.305	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.998	plasma membrane
GO:0043226	0.971	organelle
GO:0043227	0.951	membrane-bounded organelle
GO:0043231	0.931	intracellular membrane-bounded organelle
GO:0012505	0.384	endomembrane system
GO:0098857	0.383	membrane microdomain
GO:0045121	0.360	membrane raft
GO:0043232	0.356	intracellular non-membrane-bounded organelle
GO:0097708	0.355	intracellular vesicle
GO:0005634	0.309	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.723	non-specific protein-tyrosine kinase.

[back to server]