StarFunc result for job id P06340

User Input

>input (250 residues)
MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSV
DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPK
SRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFV
PSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
MGTYVSSVPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06340	1.000	1.000	1.484E-44	250	1.000	1.000	P06340.pdb.gz	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
2	AFDB:B2RST7	0.857	0.857	1.318E-34	250	0.732	0.732	B2RST7.pdb.gz	B2RST7_MOUSE Histocompatibility 2, O region alpha locus OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1
3	AFDB:P01909	0.752	0.741	7.290E-32	254	0.568	0.559	P01909.pdb.gz	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
4	AFDB:P01906	0.763	0.749	1.811E-31	255	0.540	0.529	P01906.pdb.gz	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
5	AFDB:P01910	0.810	0.792	2.634E-31	256	0.548	0.535	P01910.pdb.gz	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
6	AFDB:P20037	0.759	0.742	5.006E-31	256	0.552	0.539	P20037.pdb.gz	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
7	AFDB:P01903	0.732	0.722	1.712E-29	254	0.540	0.531	P01903.pdb.gz	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
8	AFDB:P20036	0.718	0.692	3.434E-29	260	0.548	0.527	P20036.pdb.gz	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
9	AFDB:P01904	0.720	0.706	1.620E-27	255	0.484	0.475	P01904.pdb.gz	HA21_MOUSE H-2 class II histocompatibility antigen, E-D alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=1 SV=2
10	PDB:6cplA	0.703	0.971	7.038E-25	180	0.416	0.578	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
11	AFDB:P28078	0.634	0.609	3.982E-18	261	0.268	0.257	P28078.pdb.gz	DMA_MOUSE Class II histocompatibility antigen, M alpha chain OS=Mus musculus OX=10090 GN=H2-DMa PE=1 SV=1
12	PDB:5j6hA	0.342	0.313	9.539E-10	275	0.164	0.149	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
13	PDB:1kjvB	0.378	0.921	1.062E-9	100	0.120	0.300	1kjvB.pdb.gz	Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
14	PDB:3es6A	0.340	0.311	2.129E-9	277	0.144	0.130	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
15	PDB:6e1iA	0.335	0.225	4.504E-9	389	0.132	0.085	6e1iA.pdb.gz
16	PDB:2qriA	0.396	0.251	4.752E-9	398	0.120	0.075	2qriA.pdb.gz
17	PDB:3nwmA	0.384	0.251	5.886E-9	384	0.120	0.078	3nwmA.pdb.gz
18	PDB:3ov6A	0.375	0.251	7.291E-9	376	0.116	0.077	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
19	PDB:6d7gA	0.377	0.245	1.060E-8	386	0.112	0.073	6d7gA.pdb.gz
20	PDB:6mp0A	0.375	0.242	1.542E-8	388	0.120	0.077	6mp0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06340	0.0	515	250	1.000	1.000	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
2	B2RST7	3.31e-125	357	250	0.732	0.732	B2RST7_MOUSE Histocompatibility 2, O region alpha locus OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1
3	Q31150	5.30e-125	357	250	0.732	0.732	Q31150_MOUSE MHC class II alpha chain OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1
4	Q9QWV1	7.52e-125	356	250	0.732	0.732	Q9QWV1_MOUSE H2-O alpha OS=Mus musculus OX=10090 GN=H2-Oa PE=1 SV=1
5	P01909	1.65e-98	290	254	0.564	0.555	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
6	P20037	2.10e-97	287	256	0.548	0.535	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
7	P04228	2.83e-96	284	256	0.560	0.547	HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
8	P14434	6.29e-96	283	256	0.544	0.531	HA2B_MOUSE H-2 class II histocompatibility antigen, A-B alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
9	P14436	8.65e-96	282	233	0.524	0.562	HA2R_MOUSE H-2 class II histocompatibility antigen, A-R alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
10	P01910	2.58e-95	281	256	0.548	0.535	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
11	P14437	4.83e-94	277	233	0.516	0.554	HA2S_MOUSE H-2 class II histocompatibility antigen, A-S alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
12	P01906	1.04e-93	277	255	0.516	0.506	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
13	P23150	3.96e-93	276	254	0.544	0.535	HA2J_MOUSE H-2 class II histocompatibility antigen, I-E alpha chain (Fragment) OS=Mus musculus OX=10090 PE=1 SV=1
14	P14435	4.54e-93	275	233	0.524	0.562	HA2F_MOUSE H-2 class II histocompatibility antigen, A-F alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
15	P14438	3.86e-91	270	227	0.500	0.551	HA2U_MOUSE H-2 class II histocompatibility antigen, A-U alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
16	P01903	6.21e-91	270	254	0.512	0.504	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
17	P20036	2.63e-89	266	260	0.532	0.512	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
18	X5CKE2	2.63e-89	266	260	0.532	0.512	X5CKE2_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=3 SV=1
19	Q95HB9	1.35e-88	265	260	0.536	0.515	Q95HB9_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
20	P04227	1.01e-87	261	221	0.496	0.561	HA2Q_MOUSE H-2 class II histocompatibility antigen, A-Q alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	3.3e-21	86.8	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	11	17.5	CD80-like C2-set immunoglobulin domain
3	PF13927 Ig_3	0.096	24.6	Immunoglobulin domain
4	PF00993 MHC_II_alpha	9e-28	107.1	Class II histocompatibility antigen, alpha domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229829

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363976	0.982	HLA class II histocompatibility antigen, DM alpha chain
2	9606.ENSP00000398890	0.973	HLA class II histocompatibility antigen, DM beta chain
3	9606.ENSP00000379873	0.959	HLA class I histocompatibility antigen, A-3 alpha chain
4	9606.ENSP00000399168	0.959	HLA class I histocompatibility antigen, B-7 alpha chain
5	9606.ENSP00000365402	0.954	HLA class I histocompatibility antigen, Cw-7 alpha chain
6	9606.ENSP00000390020	0.950	HLA class II histocompatibility antigen, DO beta chain
7	9606.ENSP00000009530	0.947	HLA class II histocompatibility antigen gamma chain
8	9606.ENSP00000408146	0.947	HLA class II histocompatibility antigen, DP beta 1 chain
9	9606.ENSP00000353099	0.945	HLA class II histocompatibility antigen, DRB1-15 beta chain
10	9606.ENSP00000365817	0.942	HLA class I histocompatibility antigen, alpha chain E
11	9606.ENSP00000390431	0.940	Major histocompatibility complex, class II, DQ beta 2
12	9606.ENSP00000259951	0.926	HLA class I histocompatibility antigen, alpha chain F
13	9606.ENSP00000378786	0.918	HLA class II histocompatibility antigen, DR alpha chain
14	9606.ENSP00000393566	0.918	HLA class II histocompatibility antigen, DP alpha 1 chain
15	9606.ENSP00000412457	0.895	HLA class II histocompatibility antigen, DM beta chain
16	9606.ENSP00000364080	0.852	HLA class II histocompatibility antigen, DQ beta 1 chain
17	9606.ENSP00000364114	0.819	HLA class II histocompatibility antigen, DR beta 5 chain
18	9606.ENSP00000305918	0.815	Bromodomain-containing protein 3
19	9606.ENSP00000378704	0.769	Bromodomain-containing protein 2
20	9606.ENSP00000339398	0.766	Major histocompatibility complex, class II, DQ alpha 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0033218	0.975	amide binding
GO:0003823	0.974	antigen binding
GO:0042277	0.967	peptide binding
GO:0042605	0.949	peptide antigen binding
GO:0044877	0.871	protein-containing complex binding
GO:0023023	0.670	MHC protein complex binding
GO:0038023	0.659	signaling receptor activity
GO:0004888	0.581	transmembrane signaling receptor activity
GO:0140375	0.577	immune receptor activity
GO:0005102	0.347	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0002682	0.991	regulation of immune system process
GO:0050794	0.970	regulation of cellular process
GO:0002376	0.871	immune system process
GO:0009987	0.803	cellular process
GO:0048518	0.794	positive regulation of biological process
GO:0019882	0.773	antigen processing and presentation
GO:0050863	0.756	regulation of T cell activation
GO:0048002	0.749	antigen processing and presentation of peptide antigen
GO:0002684	0.682	positive regulation of immune system process
GO:0019884	0.672	antigen processing and presentation of exogenous antigen
GO:0002478	0.651	antigen processing and presentation of exogenous peptide antigen
GO:0002495	0.619	antigen processing and presentation of peptide antigen via MHC class II
GO:0048519	0.610	negative regulation of biological process
GO:0002683	0.582	negative regulation of immune system process
GO:0048522	0.565	positive regulation of cellular process
GO:0060284	0.539	regulation of cell development
GO:0019886	0.506	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0050896	0.478	response to stimulus
GO:2000026	0.471	regulation of multicellular organismal development
GO:0051251	0.461	positive regulation of lymphocyte activation
GO:1903037	0.439	regulation of leukocyte cell-cell adhesion
GO:1903706	0.438	regulation of hemopoiesis
GO:0048583	0.393	regulation of response to stimulus
GO:0006955	0.383	immune response
GO:0050870	0.369	positive regulation of T cell activation
GO:1902105	0.331	regulation of leukocyte differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005764	1.000	lysosome
GO:0098588	0.998	bounding membrane of organelle
GO:0042613	0.997	MHC class II protein complex
GO:0005765	0.974	lysosomal membrane
GO:0012505	0.961	endomembrane system
GO:0031982	0.897	vesicle
GO:0030135	0.886	coated vesicle
GO:0005783	0.875	endoplasmic reticulum
GO:0030659	0.875	cytoplasmic vesicle membrane
GO:0030662	0.868	coated vesicle membrane
GO:0098576	0.867	lumenal side of membrane
GO:0030139	0.865	endocytic vesicle
GO:0030136	0.865	clathrin-coated vesicle
GO:0098553	0.862	lumenal side of endoplasmic reticulum membrane
GO:0045334	0.847	clathrin-coated endocytic vesicle
GO:0030666	0.840	endocytic vesicle membrane
GO:0012507	0.835	ER to Golgi transport vesicle membrane
GO:0005794	0.828	Golgi apparatus
GO:0030665	0.821	clathrin-coated vesicle membrane
GO:0000139	0.794	Golgi membrane
GO:0098791	0.778	Golgi apparatus subcompartment
GO:0030669	0.758	clathrin-coated endocytic vesicle membrane
GO:0005802	0.632	trans-Golgi network
GO:0032588	0.620	trans-Golgi network membrane
GO:0009986	0.468	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]