StarFunc result for job id P06396

User Input

>input (782 residues)
MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFL
KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNEC
SQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVV
PNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKA
TQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKL
YKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALK
TASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV
PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNY
RHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFG
GKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPS
AAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDK
KMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEK
TEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAEL
AA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6jegB	0.916	0.998	0.000	718	0.916	0.997	6jegB.pdb.gz
2	AFDB:P06396	1.000	1.000	0.000	782	1.000	1.000	P06396.pdb.gz	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
3	AFDB:E9PU64	0.291	0.318	2.124E-95	715	0.556	0.608	E9PU64.pdb.gz	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
4	AFDB:Q5ZIV9	0.292	0.318	7.298E-95	717	0.552	0.603	Q5ZIV9.pdb.gz	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
5	AFDB:A0A0R4IQ11	0.300	0.324	4.526E-94	720	0.542	0.589	A0A0R4IQ11.pdb.gz
6	AFDB:O75366	0.832	0.796	1.261E-92	819	0.431	0.411	O75366.pdb.gz	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
7	AFDB:P09327	0.578	0.547	9.745E-91	827	0.460	0.435	P09327.pdb.gz	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
8	AFDB:O88398	0.528	0.506	1.441E-87	819	0.434	0.414	O88398.pdb.gz	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
9	AFDB:O15195	0.733	0.674	6.398E-79	856	0.373	0.341	O15195.pdb.gz	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
10	AFDB:Q07171	0.733	0.720	3.988E-77	798	0.377	0.370	Q07171.pdb.gz	GELS_DROME Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2
11	AFDB:Q67U26	0.685	0.567	1.661E-70	970	0.316	0.255	Q67U26.pdb.gz	VLN3_ORYSJ Villin-3 OS=Oryza sativa subsp. japonica OX=39947 GN=VLN3 PE=2 SV=2
12	PDB:1j72A	0.139	0.312	7.716E-38	337	0.239	0.555	1j72A.pdb.gz
13	PDB:7cccB	0.111	0.235	5.960E-5	342	0.041	0.094	7cccB.pdb.gz	The structure of the actin filament uncapping complex mediated by twinfilin.
14	PDB:5kynA	0.094	0.100	5.409E-3	730	0.065	0.070	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
15	PDB:1m2vA	0.094	0.103	6.354E-3	705	0.033	0.037	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
16	PDB:1udmA	0.090	0.396	1.961E-2	149	0.018	0.094	1udmA.pdb.gz
17	PDB:1cofA	0.090	0.385	3.940E-2	135	0.020	0.119	1cofA.pdb.gz
18	PDB:4s2rP	0.064	0.079	3.940E-2	615	0.043	0.055	4s2rP.pdb.gz	Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
19	PDB:6g2iA	0.088	0.037	3.940E-2	2080	0.054	0.020	6g2iA.pdb.gz
20	PDB:1wfsA	0.094	0.346	4.158E-2	151	0.026	0.132	1wfsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JMJ1	0.0	912	720	0.543	0.590	A0JMJ1_DANRE Scinderin like a OS=Danio rerio OX=7955 GN=fb94b12 PE=1 SV=2
2	E9PU64	0.0	944	715	0.556	0.608	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
3	G1U9R8	0.0	1461	739	0.894	0.946	G1U9R8_RABIT Gelsolin OS=Oryctolagus cuniculus OX=9986 GN=GSN PE=3 SV=3
4	O75366	0.0	652	819	0.436	0.416	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
5	O88398	0.0	644	819	0.439	0.419	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
6	P06396	0.0	1621	782	1.000	1.000	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
7	P09327	0.0	697	827	0.462	0.437	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
8	P13020	0.0	1483	780	0.908	0.910	GELS_MOUSE Gelsolin OS=Mus musculus OX=10090 GN=Gsn PE=1 SV=3
9	P20305	0.0	1518	772	0.937	0.949	GELS_PIG Gelsolin (Fragment) OS=Sus scrofa OX=9823 GN=GSN PE=1 SV=1
10	Q28046	0.0	928	715	0.551	0.603	SCIN_BOVIN Scinderin OS=Bos taurus OX=9913 GN=SCIN PE=1 SV=1
11	Q5ZIV9	0.0	928	717	0.559	0.609	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
12	Q60604	0.0	942	715	0.555	0.607	SCIN_MOUSE Scinderin OS=Mus musculus OX=10090 GN=Scin PE=1 SV=3
13	Q62468	0.0	717	827	0.474	0.449	VILI_MOUSE Villin-1 OS=Mus musculus OX=10090 GN=Vil1 PE=1 SV=3
14	Q68FP1	0.0	1477	780	0.905	0.908	GELS_RAT Gelsolin OS=Rattus norvegicus OX=10116 GN=Gsn PE=1 SV=1
15	Q7TQ08	0.0	942	715	0.555	0.607	Q7TQ08_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=2 SV=1
16	Q9WU06	0.0	648	819	0.441	0.421	AVIL_RAT Advillin OS=Rattus norvegicus OX=10116 GN=Avil PE=2 SV=2
17	Q9Y6U3	0.0	927	715	0.550	0.601	SCIN_HUMAN Scinderin OS=Homo sapiens OX=9606 GN=SCIN PE=1 SV=4
18	O15195	1.66e-165	502	856	0.371	0.339	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
19	Q07171	2.77e-146	450	798	0.380	0.372	GELS_DROME Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2
20	B4DV78	4.45e-133	407	516	0.260	0.393	B4DV78_HUMAN Villin 1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03091 CutA1	4.7e+02	12.1	CutA1 divalent ion tolerance protein
2	PF00626 Gelsolin	8.1e-106	357.4	Gelsolin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362924

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355645	0.998	Actin, alpha skeletal muscle
2	9606.ENSP00000458162	0.981	Actin, cytoplasmic 2
3	9606.ENSP00000223023	0.972	Neural Wiskott-Aldrich syndrome protein
4	9606.ENSP00000311032	0.969	Caspase-3
5	9606.ENSP00000362680	0.965	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000263967	0.961	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
7	9606.ENSP00000346839	0.942	Fibronectin type III domain containing
8	9606.ENSP00000307786	0.933	Cytochrome c
9	9606.ENSP00000363822	0.912	Androgen receptor
10	9606.ENSP00000265382	0.909	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
11	9606.ENSP00000428056	0.906	Phosphatidylinositol 3-kinase regulatory subunit alpha
12	9606.ENSP00000357883	0.904	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
13	9606.ENSP00000337060	0.890	Nucleoside diphosphate kinase A
14	9606.ENSP00000349960	0.874	Actin, cytoplasmic 1
15	9606.ENSP00000317714	0.869	Syntaxin-4
16	9606.ENSP00000249700	0.863	Tropomodulin-2
17	9606.ENSP00000367220	0.843	Actin-related protein 2
18	9606.ENSP00000365745	0.837	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
19	9606.ENSP00000211998	0.836	Vinculin
20	9606.ENSP00000290378	0.810	Actin, alpha cardiac muscle 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043548	1.000	phosphatidylinositol 3-kinase binding
GO:0019900	1.000	kinase binding
GO:0003779	1.000	actin binding
GO:0043167	0.996	ion binding
GO:0005509	0.990	calcium ion binding
GO:0045159	0.816	myosin II binding
GO:0044877	0.672	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0016043	0.957	cellular component organization
GO:0008154	0.951	actin polymerization or depolymerization
GO:0043254	0.937	regulation of protein-containing complex assembly
GO:0110053	0.933	regulation of actin filament organization
GO:0022411	0.929	cellular component disassembly
GO:0051261	0.913	protein depolymerization
GO:0048519	0.907	negative regulation of biological process
GO:0051129	0.903	negative regulation of cellular component organization
GO:1902904	0.879	negative regulation of supramolecular fiber organization
GO:0032271	0.876	regulation of protein polymerization
GO:0043244	0.875	regulation of protein-containing complex disassembly
GO:1901879	0.866	regulation of protein depolymerization
GO:0030042	0.863	actin filament depolymerization
GO:0008064	0.852	regulation of actin polymerization or depolymerization
GO:0048518	0.851	positive regulation of biological process
GO:0043242	0.846	negative regulation of protein-containing complex disassembly
GO:0050896	0.829	response to stimulus
GO:0032501	0.828	multicellular organismal process
GO:1901880	0.819	negative regulation of protein depolymerization
GO:0048522	0.804	positive regulation of cellular process
GO:0010639	0.798	negative regulation of organelle organization
GO:0051494	0.783	negative regulation of cytoskeleton organization
GO:0030834	0.752	regulation of actin filament depolymerization
GO:0022607	0.731	cellular component assembly
GO:0031333	0.728	negative regulation of protein-containing complex assembly
GO:0030835	0.719	negative regulation of actin filament depolymerization
GO:0030833	0.712	regulation of actin filament polymerization
GO:0032272	0.676	negative regulation of protein polymerization
GO:0030837	0.646	negative regulation of actin filament polymerization
GO:0051693	0.613	actin filament capping
GO:0019222	0.591	regulation of metabolic process
GO:0065003	0.518	protein-containing complex assembly
GO:0080090	0.488	regulation of primary metabolic process
GO:0060255	0.451	regulation of macromolecule metabolic process
GO:0051171	0.437	regulation of nitrogen compound metabolic process
GO:0009893	0.425	positive regulation of metabolic process
GO:0032502	0.405	developmental process
GO:0051716	0.396	cellular response to stimulus
GO:0051130	0.392	positive regulation of cellular component organization
GO:0008152	0.380	metabolic process
GO:0010604	0.378	positive regulation of macromolecule metabolic process
GO:0051179	0.373	localization
GO:0048856	0.361	anatomical structure development
GO:0065009	0.356	regulation of molecular function
GO:0051246	0.334	regulation of protein metabolic process
GO:0050790	0.320	regulation of catalytic activity
GO:0051173	0.318	positive regulation of nitrogen compound metabolic process
GO:0010468	0.314	regulation of gene expression
GO:0071704	0.307	organic substance metabolic process
GO:0042221	0.305	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0070062	0.996	extracellular exosome
GO:0070013	0.993	intracellular organelle lumen
GO:0032991	0.990	protein-containing complex
GO:0071944	0.990	cell periphery
GO:0012505	0.990	endomembrane system
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0016020	0.975	membrane
GO:0005856	0.925	cytoskeleton
GO:0015629	0.895	actin cytoskeleton
GO:0030054	0.885	cell junction
GO:0031410	0.868	cytoplasmic vesicle
GO:0030055	0.861	cell-substrate junction
GO:0005925	0.853	focal adhesion
GO:0005886	0.837	plasma membrane
GO:0120025	0.825	plasma membrane bounded cell projection
GO:0031252	0.813	cell leading edge
GO:0030141	0.798	secretory granule
GO:0005634	0.647	nucleus
GO:0031981	0.491	nuclear lumen
GO:0034774	0.426	secretory granule lumen
GO:0005654	0.420	nucleoplasm
GO:0072562	0.376	blood microparticle
GO:0030027	0.300	lamellipodium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]