StarFunc result for job id P06400

User Input

>input (928 residues)
MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYK
TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0D9RYS3	0.793	0.793	0.000	928	0.992	0.992	A0A0D9RYS3.pdb.gz	A0A0D9RYS3_CHLSB RB transcriptional corepressor 1 OS=Chlorocebus sabaeus OX=60711 GN=RB1 PE=3 SV=1
2	AFDB:Q9YGE5	0.738	0.752	1.273E-70	910	0.545	0.556	Q9YGE5.pdb.gz	Q9YGE5_ONCMY Retinoblastoma 1 OS=Oncorhynchus mykiss OX=8022 GN=RB1 PE=2 SV=1
3	AFDB:A0JMQ4	0.722	0.740	2.950E-69	903	0.523	0.537	A0JMQ4.pdb.gz	A0JMQ4_DANRE Retinoblastoma 1 OS=Danio rerio OX=7955 GN=zgc:154147 PE=1 SV=1
4	AFDB:Q08999	0.575	0.478	1.279E-33	1139	0.283	0.231	Q08999.pdb.gz	RBL2_HUMAN Retinoblastoma-like protein 2 OS=Homo sapiens OX=9606 GN=RBL2 PE=1 SV=3
5	AFDB:P28749	0.614	0.540	3.177E-33	1068	0.277	0.241	P28749.pdb.gz	RBL1_HUMAN Retinoblastoma-like protein 1 OS=Homo sapiens OX=9606 GN=RBL1 PE=1 SV=3
6	AFDB:Q9LKZ3	0.520	0.484	4.481E-29	1013	0.217	0.198	Q9LKZ3.pdb.gz	RBR1_ARATH Retinoblastoma-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=RBR1 PE=1 SV=1
7	AFDB:Q66WV0	0.533	0.499	6.776E-29	1003	0.224	0.207	Q66WV0.pdb.gz	RBR1_NICBE Retinoblastoma-related protein 1 OS=Nicotiana benthamiana OX=4100 GN=RBR1 PE=2 SV=1
8	AFDB:Q24472	0.533	0.580	2.803E-27	845	0.200	0.220	Q24472.pdb.gz	RBF_DROME Retinoblastoma family protein OS=Drosophila melanogaster OX=7227 GN=Rbf PE=1 SV=2
9	AFDB:Q54FX2	0.519	0.378	1.659E-26	1312	0.209	0.148	Q54FX2.pdb.gz	RBLA_DICDI Retinoblastoma-like protein A OS=Dictyostelium discoideum OX=44689 GN=rblA PE=2 SV=1
10	AFDB:Q9VF04	0.323	0.380	1.158E-22	783	0.165	0.195	Q9VF04.pdb.gz	Q9VF04_DROME RE32990p OS=Drosophila melanogaster OX=7227 GN=Rbf2 PE=2 SV=1
11	PDB:7zs9M	0.117	0.282	1.084E-1	310	0.043	0.129	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
12	PDB:5uwuC	0.109	0.105	8.576E-1	998	0.093	0.086	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
13	PDB:7ml4M	0.083	0.303	9.315E-1	234	0.027	0.107	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
14	PDB:6ahoA	0.100	0.101	1.012	916	0.107	0.108	6ahoA.pdb.gz
15	PDB:5iy6M	0.099	0.296	1.099	260	0.027	0.096	5iy6M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
16	PDB:1dcnB	0.067	0.116	1.194	418	0.058	0.129	1dcnB.pdb.gz	Crystal structure of an inactive duck delta II crystallin mutant with bound argininosuccinate.
17	PDB:3wyfC	0.100	0.093	1.297	1040	0.099	0.088	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
18	PDB:4flcB	0.070	0.116	1.352	464	0.061	0.123	4flcB.pdb.gz
19	PDB:4v1nM	0.095	0.225	1.352	299	0.031	0.097	4v1nM.pdb.gz	Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
20	PDB:5ze6A	0.078	0.167	1.352	315	0.043	0.127	5ze6A.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9RYS3	0.0	1904	928	0.992	0.992	A0A0D9RYS3_CHLSB RB transcriptional corepressor 1 OS=Chlorocebus sabaeus OX=60711 GN=RB1 PE=3 SV=1
2	A0JMQ4	0.0	912	903	0.540	0.555	A0JMQ4_DANRE Retinoblastoma 1 OS=Danio rerio OX=7955 GN=zgc:154147 PE=1 SV=1
3	P06400	0.0	1920	928	1.000	1.000	RB_HUMAN Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2
4	P13405	0.0	1687	921	0.883	0.889	RB_MOUSE Retinoblastoma-associated protein OS=Mus musculus OX=10090 GN=Rb1 PE=1 SV=2
5	P33568	0.0	1699	920	0.889	0.897	RB_RAT Retinoblastoma-associated protein OS=Rattus norvegicus OX=10116 GN=Rb1 PE=1 SV=3
6	Q9YGE5	0.0	1004	910	0.553	0.564	Q9YGE5_ONCMY Retinoblastoma 1 OS=Oncorhynchus mykiss OX=8022 GN=RB1 PE=2 SV=1
7	Q08999	1.44e-46	183	1139	0.178	0.145	RBL2_HUMAN Retinoblastoma-like protein 2 OS=Homo sapiens OX=9606 GN=RBL2 PE=1 SV=3
8	Q64701	1.71e-46	183	1063	0.188	0.164	RBL1_MOUSE Retinoblastoma-like protein 1 OS=Mus musculus OX=10090 GN=Rbl1 PE=1 SV=3
9	P28749	1.85e-46	183	1068	0.173	0.151	RBL1_HUMAN Retinoblastoma-like protein 1 OS=Homo sapiens OX=9606 GN=RBL1 PE=1 SV=3
10	Q64700	4.92e-46	182	1135	0.168	0.137	RBL2_MOUSE Retinoblastoma-like protein 2 OS=Mus musculus OX=10090 GN=Rbl2 PE=1 SV=3
11	Q9LKZ3	9.79e-46	180	1013	0.222	0.203	RBR1_ARATH Retinoblastoma-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=RBR1 PE=1 SV=1
12	Q66WV0	1.14e-45	180	1003	0.199	0.184	RBR1_NICBE Retinoblastoma-related protein 1 OS=Nicotiana benthamiana OX=4100 GN=RBR1 PE=2 SV=1
13	O55081	2.40e-45	179	1135	0.157	0.129	RBL2_RAT Retinoblastoma-like protein 2 OS=Rattus norvegicus OX=10116 GN=Rbl2 PE=1 SV=1
14	Q24472	4.21e-35	146	845	0.206	0.226	RBF_DROME Retinoblastoma family protein OS=Drosophila melanogaster OX=7227 GN=Rbf PE=1 SV=2
15	G5EDT1	1.10e-19	97.4	961	0.110	0.106	LIN35_CAEEL Retinoblastoma-like protein homolog lin-35 OS=Caenorhabditis elegans OX=6239 GN=lin-35 PE=1 SV=1
16	Q9NIS1	3.45e-18	92.4	782	0.178	0.211	Q9NIS1_DROME RB-related protein RBF2 OS=Drosophila melanogaster OX=7227 GN=Rbf2 PE=3 SV=1
17	Q54FX2	1.00e-17	91.3	1312	0.085	0.060	RBLA_DICDI Retinoblastoma-like protein A OS=Dictyostelium discoideum OX=44689 GN=rblA PE=2 SV=1
18	Q9VF04	1.37e-17	90.5	783	0.177	0.209	Q9VF04_DROME RE32990p OS=Drosophila melanogaster OX=7227 GN=Rbf2 PE=2 SV=1
19	H0YE05	2.84e-08	58.2	254	0.056	0.205	H0YE05_HUMAN RB transcriptional corepressor like 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBL1 PE=1 SV=8
20	D3ZWX4	0.066	39.3	705	0.040	0.052	D3ZWX4_RAT NCK interacting protein with SH3 domain OS=Rattus norvegicus OX=10116 GN=Nckipsd PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11934 DUF3452	6.8e-08	43.6	Domain of unknown function (DUF3452)
2	PF01858 RB_A	3.8e-70	247.3	Retinoblastoma-associated protein A domain
3	PF01857 RB_B	1.7e-31	120.3	Retinoblastoma-associated protein B domain
4	PF08934 Rb_C	6.5e-80	277.8	Rb C-terminal domain
5	PF00382 TFIIB	51	15.3	Transcription factor TFIIB repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267163

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257904	0.999	Cyclin-dependent kinase 4
2	9606.ENSP00000262904	0.999	Transcription factor E2F3
3	9606.ENSP00000345571	0.999	Transcription factor E2F1
4	9606.ENSP00000352516	0.999	DNA (cytosine-5)-methyltransferase 1
5	9606.ENSP00000362649	0.999	Histone deacetylase 1
6	9606.ENSP00000368686	0.999	Transcription factor E2F4
7	9606.ENSP00000227507	0.998	G1/S-specific cyclin-D1
8	9606.ENSP00000258149	0.998	E3 ubiquitin-protein ligase Mdm2
9	9606.ENSP00000355249	0.998	Transcription factor E2F2
10	9606.ENSP00000364519	0.998	Transcription factor Dp-1
11	9606.ENSP00000265734	0.997	Cyclin-dependent kinase 6
12	9606.ENSP00000266970	0.997	Cyclin-dependent kinase 2
13	9606.ENSP00000274026	0.996	Cyclin-A2
14	9606.ENSP00000378699	0.996	Cyclin-dependent kinase 1
15	9606.ENSP00000262643	0.995	G1/S-specific cyclin-E1
16	9606.ENSP00000329357	0.995	Transcription factor Sp1
17	9606.ENSP00000362592	0.995	Histone-binding protein RBBP4
18	9606.ENSP00000395654	0.993	Transcription activator BRG1
19	9606.ENSP00000261254	0.992	G1/S-specific cyclin-D2
20	9606.ENSP00000360493	0.992	Runt-related transcription factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0097718	0.990	disordered domain specific binding
GO:1901363	0.780	heterocyclic compound binding
GO:0097159	0.780	organic cyclic compound binding
GO:0003676	0.760	nucleic acid binding
GO:0008134	0.706	transcription factor binding
GO:0003677	0.656	DNA binding
GO:0140297	0.560	DNA-binding transcription factor binding
GO:0003690	0.458	double-stranded DNA binding
GO:1990837	0.439	sequence-specific double-stranded DNA binding
GO:0019899	0.403	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048523	0.993	negative regulation of cellular process
GO:0080090	0.991	regulation of primary metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0031323	0.990	regulation of cellular metabolic process
GO:0009987	0.987	cellular process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0009892	0.985	negative regulation of metabolic process
GO:0010605	0.982	negative regulation of macromolecule metabolic process
GO:0032502	0.978	developmental process
GO:0050896	0.975	response to stimulus
GO:0051726	0.975	regulation of cell cycle
GO:0031324	0.972	negative regulation of cellular metabolic process
GO:0045786	0.971	negative regulation of cell cycle
GO:0051172	0.968	negative regulation of nitrogen compound metabolic process
GO:0048518	0.965	positive regulation of biological process
GO:0001932	0.956	regulation of protein phosphorylation
GO:1903506	0.946	regulation of nucleic acid-templated transcription
GO:0006357	0.935	regulation of transcription by RNA polymerase II
GO:0051248	0.934	negative regulation of protein metabolic process
GO:1901987	0.927	regulation of cell cycle phase transition
GO:0045934	0.926	negative regulation of nucleobase-containing compound metabolic process
GO:0000122	0.917	negative regulation of transcription by RNA polymerase II
GO:0045859	0.915	regulation of protein kinase activity
GO:0031400	0.911	negative regulation of protein modification process
GO:0071840	0.905	cellular component organization or biogenesis
GO:0007346	0.905	regulation of mitotic cell cycle
GO:0043086	0.899	negative regulation of catalytic activity
GO:1903047	0.891	mitotic cell cycle process
GO:0048522	0.887	positive regulation of cellular process
GO:0010563	0.887	negative regulation of phosphorus metabolic process
GO:1901990	0.881	regulation of mitotic cell cycle phase transition
GO:0044772	0.876	mitotic cell cycle phase transition
GO:0032501	0.874	multicellular organismal process
GO:0016043	0.870	cellular component organization
GO:2000045	0.864	regulation of G1/S transition of mitotic cell cycle
GO:2000134	0.853	negative regulation of G1/S transition of mitotic cell cycle
GO:0051348	0.840	negative regulation of transferase activity
GO:0045936	0.839	negative regulation of phosphate metabolic process
GO:0044843	0.827	cell cycle G1/S phase transition
GO:0000082	0.823	G1/S transition of mitotic cell cycle
GO:0042326	0.787	negative regulation of phosphorylation
GO:0008152	0.749	metabolic process
GO:0048856	0.739	anatomical structure development
GO:0009893	0.716	positive regulation of metabolic process
GO:0051173	0.702	positive regulation of nitrogen compound metabolic process
GO:0010604	0.698	positive regulation of macromolecule metabolic process
GO:0051716	0.695	cellular response to stimulus
GO:0071704	0.658	organic substance metabolic process
GO:0044238	0.645	primary metabolic process
GO:0048583	0.628	regulation of response to stimulus
GO:0001933	0.591	negative regulation of protein phosphorylation
GO:0006807	0.580	nitrogen compound metabolic process
GO:0031325	0.552	positive regulation of cellular metabolic process
GO:0044237	0.547	cellular metabolic process
GO:0007154	0.538	cell communication
GO:0043170	0.492	macromolecule metabolic process
GO:0007165	0.443	signal transduction
GO:0044093	0.439	positive regulation of molecular function
GO:0010629	0.413	negative regulation of gene expression
GO:0023051	0.411	regulation of signaling
GO:0010646	0.410	regulation of cell communication
GO:0048869	0.377	cellular developmental process
GO:0045935	0.370	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.365	positive regulation of macromolecule biosynthetic process
GO:0031328	0.365	positive regulation of cellular biosynthetic process
GO:1903508	0.357	positive regulation of nucleic acid-templated transcription
GO:0045893	0.354	positive regulation of DNA-templated transcription
GO:0033673	0.351	negative regulation of kinase activity
GO:0051128	0.350	regulation of cellular component organization
GO:0030154	0.346	cell differentiation
GO:0006469	0.343	negative regulation of protein kinase activity
GO:0006950	0.323	response to stress
GO:0042221	0.317	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.993	protein-containing complex
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005737	0.955	cytoplasm
GO:0005829	0.952	cytosol
GO:0140513	0.891	nuclear protein-containing complex
GO:0005667	0.619	transcription regulator complex
GO:0090575	0.488	RNA polymerase II transcription regulator complex
GO:0005694	0.476	chromosome
GO:0000785	0.465	chromatin
GO:1902494	0.463	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]