StarFunc result for job id P06401

User Input

>input (933 residues)
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA
AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK
PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC
KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP
YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPV
GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ
LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06401	1.000	1.000	1.742E-102	933	1.000	1.000	P06401.pdb.gz	PRGR_HUMAN Progesterone receptor OS=Homo sapiens OX=9606 GN=PGR PE=1 SV=4
2	AFDB:D0EWS6	0.358	0.358	7.235E-84	934	0.854	0.853	D0EWS6.pdb.gz	D0EWS6_PIG Progesterone receptor OS=Sus scrofa OX=9823 GN=PGR PE=2 SV=1
3	AFDB:Q00175	0.456	0.459	5.038E-83	926	0.802	0.808	Q00175.pdb.gz	PRGR_MOUSE Progesterone receptor OS=Mus musculus OX=10090 GN=Pgr PE=1 SV=2
4	AFDB:Q9GLW0	0.504	0.501	1.655E-77	939	0.767	0.763	Q9GLW0.pdb.gz	PRGR_CANLF Progesterone receptor OS=Canis lupus familiaris OX=9615 GN=PGR PE=2 SV=1
5	AFDB:A6YIH7	0.335	0.323	8.001E-37	970	0.327	0.314	A6YIH7.pdb.gz	A6YIH7_DANRE Mineralocorticoid receptor OS=Danio rerio OX=7955 GN=mr PE=2 SV=1
6	AFDB:B0ZBF6	0.285	0.272	4.428E-35	984	0.323	0.306	B0ZBF6.pdb.gz	B0ZBF6_HUMAN Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=4 SV=1
7	AFDB:C1KB84	0.282	0.269	5.521E-35	986	0.337	0.318	C1KB84.pdb.gz	C1KB84_CHICK Mineralocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C2 PE=2 SV=1
8	AFDB:G1K325	0.270	0.267	4.956E-28	942	0.289	0.287	G1K325.pdb.gz
9	PDB:7kw7F	0.234	0.812	1.249E-19	259	0.148	0.533	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
10	PDB:3dzyA	0.196	0.570	6.839E-12	302	0.084	0.258	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
11	PDB:1g2nA	0.203	0.689	7.136E-7	246	0.061	0.232	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
12	PDB:6fx0A	0.203	0.700	2.454E-6	238	0.043	0.168	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	AFDB:O43432	0.064	0.044	2.018E-2	1585	0.154	0.091	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
14	PDB:7wq3R	0.082	0.177	3.221E-2	289	0.028	0.090	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
15	AFDB:Q80XI3	0.071	0.049	5.564E-2	1579	0.164	0.097	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
16	PDB:7vv6R	0.065	0.153	2.243E-1	271	0.029	0.100	7vv6R.pdb.gz	Structure, function and pharmacology of human itch receptor complexes.
17	PDB:5ganA	0.065	0.037	3.487E-1	2196	0.042	0.018	5ganA.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
18	PDB:7wicR	0.078	0.187	3.808E-1	288	0.028	0.090	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
19	PDB:7fiiR	0.066	0.093	5.919E-1	570	0.029	0.047	7fiiR.pdb.gz
20	PDB:7xowR	0.072	0.166	5.919E-1	276	0.030	0.101	7xowR.pdb.gz	Structural insights into human brain-gut peptide cholecystokinin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9V3N7	0.0	538	617	0.263	0.397	C9V3N7_DANRE Nuclear progesterone receptor Pgr OS=Danio rerio OX=7955 GN=pr PE=2 SV=1
2	D0EWS6	0.0	1414	934	0.854	0.853	D0EWS6_PIG Progesterone receptor OS=Sus scrofa OX=9823 GN=PGR PE=2 SV=1
3	F1SV76	0.0	1416	934	0.855	0.854	F1SV76_PIG Progesterone receptor OS=Sus scrofa OX=9823 GN=PGR PE=3 SV=3
4	P06401	0.0	1878	933	1.000	1.000	PRGR_HUMAN Progesterone receptor OS=Homo sapiens OX=9606 GN=PGR PE=1 SV=4
5	P07812	0.0	837	786	0.556	0.660	PRGR_CHICK Progesterone receptor OS=Gallus gallus OX=9031 GN=PGR PE=1 SV=1
6	Q00175	0.0	1388	926	0.802	0.808	PRGR_MOUSE Progesterone receptor OS=Mus musculus OX=10090 GN=Pgr PE=1 SV=2
7	Q63449	0.0	1397	923	0.807	0.816	PRGR_RAT Progesterone receptor OS=Rattus norvegicus OX=10116 GN=Pgr PE=2 SV=1
8	Q690N0	0.0	890	482	0.486	0.940	Q690N0_BOVIN Progesterone receptor (Fragment) OS=Bos taurus OX=9913 GN=PGR PE=2 SV=1
9	Q9GLW0	0.0	1200	939	0.755	0.750	PRGR_CANLF Progesterone receptor OS=Canis lupus familiaris OX=9615 GN=PGR PE=2 SV=1
10	Q1XHK0	4.53e-152	468	746	0.247	0.308	Q1XHK0_DANRE Glucocorticoid receptor OS=Danio rerio OX=7955 GN=fb13f09 PE=2 SV=1
11	G1NEJ8	7.48e-152	454	374	0.222	0.553	G1NEJ8_MELGA Uncharacterized protein OS=Meleagris gallopavo OX=9103 GN=AR PE=3 SV=2
12	A6YIH7	2.79e-151	473	970	0.234	0.225	A6YIH7_DANRE Mineralocorticoid receptor OS=Danio rerio OX=7955 GN=mr PE=2 SV=1
13	Q6RKQ3	2.50e-149	459	669	0.234	0.326	Q6RKQ3_ONCMY Glucocorticoid receptor OS=Oncorhynchus mykiss OX=8022 GN=nr3c1 PE=2 SV=1
14	Q2VP86	1.29e-148	457	684	0.220	0.300	Q2VP86_TAEGU Androgen receptor OS=Taeniopygia guttata OX=59729 PE=2 SV=1
15	Q38HX7	6.84e-148	458	772	0.229	0.277	Q38HX7_CHICK Glucocorticoid receptor OS=Gallus gallus OX=9031 GN=GR PE=2 SV=1
16	A0A1D5PRD7	1.12e-147	458	772	0.229	0.277	A0A1D5PRD7_CHICK Glucocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C1 PE=1 SV=1
17	P06537	1.47e-146	456	792	0.233	0.274	GCR_MOUSE Glucocorticoid receptor OS=Mus musculus OX=10090 GN=Nr3c1 PE=1 SV=2
18	Q9I8F5	6.95e-145	452	839	0.228	0.254	Q9I8F5_PIMPR Androgen receptor OS=Pimephales promelas OX=90988 PE=2 SV=2
19	F1D8N4	4.50e-144	449	777	0.224	0.269	F1D8N4_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=2 SV=1
20	P04150	4.50e-144	449	777	0.224	0.269	GCR_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	5.4e-25	99.8	Ligand-binding domain of nuclear hormone receptor
2	PF02161 Prog_receptor	0	1065.0	Progesterone receptor
3	PF00105 zf-C4	8.6e-23	91.9	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325120

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
2	9606.ENSP00000335153	0.996	Heat shock protein HSP 90-alpha
3	9606.ENSP00000385216	0.996	Nuclear receptor coactivator 1
4	9606.ENSP00000361066	0.992	Nuclear receptor coactivator 3
5	9606.ENSP00000444810	0.988	Peptidyl-prolyl cis-trans isomerase FKBP5
6	9606.ENSP00000384018	0.977	Nuclear receptor corepressor 2
7	9606.ENSP00000302961	0.962	Heat shock protein family A member 4
8	9606.ENSP00000263025	0.959	Mitogen-activated protein kinase 3
9	9606.ENSP00000264657	0.953	Signal transducer and activator of transcription 3
10	9606.ENSP00000342235	0.953	Receptor tyrosine-protein kinase erbB-4
11	9606.ENSP00000405330	0.952	Estrogen receptor
12	9606.ENSP00000215832	0.944	Mitogen-activated protein kinase 1
13	9606.ENSP00000268712	0.941	Nuclear receptor corepressor 1
14	9606.ENSP00000269571	0.941	Receptor tyrosine-protein kinase erbB-2
15	9606.ENSP00000376765	0.931	E3 SUMO-protein ligase PIAS3
16	9606.ENSP00000263967	0.920	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
17	9606.ENSP00000348056	0.917	SUMO-conjugating enzyme UBC9
18	9606.ENSP00000320130	0.906	Cytoplasmic dynein 1 intermediate chain 1
19	9606.ENSP00000380308	0.906	Cytoplasmic dynein 1 intermediate chain 2
20	9606.ENSP00000001008	0.905	Peptidyl-prolyl cis-trans isomerase FKBP4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003707	1.000	nuclear steroid receptor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.977	transcription factor binding
GO:0003690	0.970	double-stranded DNA binding
GO:1990837	0.964	sequence-specific double-stranded DNA binding
GO:0019899	0.957	enzyme binding
GO:0000978	0.942	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.841	identical protein binding
GO:0001228	0.784	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0005102	0.776	signaling receptor binding
GO:0001221	0.768	transcription coregulator binding
GO:0001223	0.730	transcription coactivator binding
GO:0051117	0.698	ATPase binding
GO:0098531	0.515	ligand-activated transcription factor activity
GO:0004879	0.453	nuclear receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0050896	0.981	response to stimulus
GO:0019222	0.972	regulation of metabolic process
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0031323	0.936	regulation of cellular metabolic process
GO:0010468	0.935	regulation of gene expression
GO:0080090	0.931	regulation of primary metabolic process
GO:0051171	0.930	regulation of nitrogen compound metabolic process
GO:0051716	0.920	cellular response to stimulus
GO:0048519	0.919	negative regulation of biological process
GO:0009889	0.885	regulation of biosynthetic process
GO:0031326	0.883	regulation of cellular biosynthetic process
GO:0019219	0.882	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.880	regulation of macromolecule biosynthetic process
GO:0048518	0.866	positive regulation of biological process
GO:0006355	0.866	regulation of DNA-templated transcription
GO:0032501	0.836	multicellular organismal process
GO:0048522	0.808	positive regulation of cellular process
GO:0042221	0.801	response to chemical
GO:0007154	0.752	cell communication
GO:0007165	0.735	signal transduction
GO:0009893	0.711	positive regulation of metabolic process
GO:0010033	0.692	response to organic substance
GO:0010604	0.612	positive regulation of macromolecule metabolic process
GO:0051173	0.510	positive regulation of nitrogen compound metabolic process
GO:0031325	0.510	positive regulation of cellular metabolic process
GO:0009891	0.473	positive regulation of biosynthetic process
GO:0032502	0.462	developmental process
GO:0031328	0.456	positive regulation of cellular biosynthetic process
GO:0045935	0.456	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.451	positive regulation of macromolecule biosynthetic process
GO:0009892	0.435	negative regulation of metabolic process
GO:0045893	0.420	positive regulation of DNA-templated transcription
GO:0006357	0.414	regulation of transcription by RNA polymerase II
GO:0048523	0.411	negative regulation of cellular process
GO:0048856	0.393	anatomical structure development
GO:0010605	0.389	negative regulation of macromolecule metabolic process
GO:0045944	0.376	positive regulation of transcription by RNA polymerase II
GO:0009719	0.364	response to endogenous stimulus
GO:0008152	0.359	metabolic process
GO:0070887	0.347	cellular response to chemical stimulus
GO:0051239	0.326	regulation of multicellular organismal process
GO:0007275	0.315	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.999	nuclear lumen
GO:0005829	0.991	cytosol
GO:0005654	0.989	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]