StarFunc result for job id P06454

User Input

>input (111 residues)
MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEG
GEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:P23614	0.198	0.106	5.189	244	0.189	0.086	P23614.pdb.gz	BASP1_CHICK Brain acid soluble protein 1 homolog OS=Gallus gallus OX=9031 GN=BASP1 PE=2 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06454	3.20e-64	191	111	1.000	1.000	PTMA_HUMAN Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2
2	Q53S24	4.77e-62	186	110	0.991	1.000	Q53S24_HUMAN Prothymosin, alpha OS=Homo sapiens OX=9606 GN=PTMAP7 PE=2 SV=1
3	Q8TBK9	6.15e-61	183	110	0.982	0.991	Q8TBK9_HUMAN Prothymosin, alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=1
4	P01252	1.05e-60	182	110	0.973	0.982	PTMA_BOVIN Prothymosin alpha OS=Bos taurus OX=9913 GN=PTMA PE=1 SV=2
5	B8ZZA1	1.27e-59	181	131	0.973	0.824	B8ZZA1_HUMAN Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=1
6	B8ZZQ6	2.73e-58	176	107	0.964	1.000	B8ZZQ6_HUMAN Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=1
7	B8ZZW7	2.10e-51	160	136	0.865	0.706	B8ZZW7_HUMAN Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=1
8	H7C2N1	2.51e-51	160	148	0.865	0.649	H7C2N1_HUMAN Prothymosin alpha (Fragment) OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=1
9	P06302	4.73e-27	97.8	112	0.955	0.946	PTMA_RAT Prothymosin alpha OS=Rattus norvegicus OX=10116 GN=Ptma PE=1 SV=2
10	P26350	8.37e-27	97.4	111	0.955	0.955	PTMA_MOUSE Prothymosin alpha OS=Mus musculus OX=10090 GN=Ptma PE=1 SV=2
11	Q9UMZ1	1.04e-21	84.0	101	0.802	0.881	Q9UMZ1_HUMAN Prothymosin a14 OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03247 Prothymosin	8.9e-32	121.1	Prothymosin/parathymosin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344547

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000171111	0.997	Kelch-like ECH-associated protein 1
2	9606.ENSP00000344504	0.978	Histone H1.0
3	9606.ENSP00000478828	0.965	Parathymosin
4	9606.ENSP00000230671	0.833	Sodium-dependent proline transporter
5	9606.ENSP00000448165	0.827	Apoptotic protease-activating factor 1
6	9606.ENSP00000263253	0.825	Histone acetyltransferase p300
7	9606.ENSP00000405965	0.802	Small ubiquitin-related modifier 2
8	9606.ENSP00000379003	0.794	Nuclear protein 1, transcriptional regulator
9	9606.ENSP00000482075	0.784	Prostaglandin E synthase 3
10	9606.ENSP00000263238	0.773	Actin-related protein 3
11	9606.ENSP00000417864	0.772	Acidic leucine-rich nuclear phosphoprotein 32 family member A
12	9606.ENSP00000361777	0.765	Protein SET
13	9606.ENSP00000359988	0.747	Serine/arginine-rich splicing factor 11
14	9606.ENSP00000357688	0.709	Protein S100-A13
15	9606.ENSP00000339795	0.708	60S ribosomal protein L7
16	9606.ENSP00000289371	0.693	Eukaryotic translation initiation factor 5B
17	9606.ENSP00000376276	0.686	Serine/arginine-rich splicing factor 2
18	9606.ENSP00000346037	0.685	60S acidic ribosomal protein P1
19	9606.ENSP00000228136	0.681	Small acidic protein
20	9606.ENSP00000217515	0.676	Thioredoxin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140297	0.520	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.997	cellular process
GO:0044237	0.990	cellular metabolic process
GO:0044238	0.988	primary metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0046483	0.968	heterocycle metabolic process
GO:1901360	0.962	organic cyclic compound metabolic process
GO:0010941	0.962	regulation of cell death
GO:0060255	0.956	regulation of macromolecule metabolic process
GO:0048519	0.955	negative regulation of biological process
GO:0048523	0.950	negative regulation of cellular process
GO:0043067	0.947	regulation of programmed cell death
GO:0042981	0.939	regulation of apoptotic process
GO:0060548	0.939	negative regulation of cell death
GO:0043069	0.922	negative regulation of programmed cell death
GO:0034641	0.920	cellular nitrogen compound metabolic process
GO:0006725	0.918	cellular aromatic compound metabolic process
GO:0006325	0.907	chromatin organization
GO:0043066	0.898	negative regulation of apoptotic process
GO:0006139	0.872	nucleobase-containing compound metabolic process
GO:0051171	0.868	regulation of nitrogen compound metabolic process
GO:0080090	0.796	regulation of primary metabolic process
GO:0048518	0.795	positive regulation of biological process
GO:0031323	0.773	regulation of cellular metabolic process
GO:0009892	0.738	negative regulation of metabolic process
GO:0090304	0.726	nucleic acid metabolic process
GO:0009058	0.697	biosynthetic process
GO:0010468	0.683	regulation of gene expression
GO:0019219	0.683	regulation of nucleobase-containing compound metabolic process
GO:0010467	0.678	gene expression
GO:0031326	0.648	regulation of cellular biosynthetic process
GO:0010556	0.644	regulation of macromolecule biosynthetic process
GO:0051252	0.638	regulation of RNA metabolic process
GO:0048522	0.611	positive regulation of cellular process
GO:0044249	0.587	cellular biosynthetic process
GO:0009893	0.541	positive regulation of metabolic process
GO:0010605	0.531	negative regulation of macromolecule metabolic process
GO:0010604	0.455	positive regulation of macromolecule metabolic process
GO:0016070	0.453	RNA metabolic process
GO:0006355	0.452	regulation of DNA-templated transcription
GO:0065009	0.418	regulation of molecular function
GO:0051246	0.416	regulation of protein metabolic process
GO:1901576	0.404	organic substance biosynthetic process
GO:0051173	0.402	positive regulation of nitrogen compound metabolic process
GO:0044271	0.381	cellular nitrogen compound biosynthetic process
GO:0051172	0.374	negative regulation of nitrogen compound metabolic process
GO:0009059	0.351	macromolecule biosynthetic process
GO:0031325	0.323	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0032991	0.501	protein-containing complex
GO:0071944	0.450	cell periphery
GO:0030426	0.377	growth cone
GO:0030863	0.377	cortical cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]