StarFunc result for job id P06576

User Input

>input (529 residues)
MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAAT
GRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLV
RGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT
REGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQD
VLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAI
YVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDV
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGK
LVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5ZLC5	0.932	0.925	3.114E-96	533	0.922	0.916	Q5ZLC5.pdb.gz	ATPB_CHICK ATP synthase subunit beta, mitochondrial OS=Gallus gallus OX=9031 GN=ATP5F1B PE=1 SV=1
2	AFDB:Q05825	0.895	0.938	7.521E-91	505	0.826	0.865	Q05825.pdb.gz	ATPB_DROME ATP synthase subunit beta, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynbeta PE=1 SV=3
3	AFDB:P46561	0.890	0.876	2.365E-88	538	0.800	0.786	P46561.pdb.gz	ATPB_CAEEL ATP synthase subunit beta, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=atp-2 PE=1 SV=2
4	AFDB:Q01859	0.911	0.873	5.247E-85	552	0.741	0.710	Q01859.pdb.gz	ATPBM_ORYSJ ATP synthase subunit beta, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=ATPB PE=1 SV=2
5	AFDB:Q9C5A9	0.893	0.845	4.141E-84	559	0.728	0.689	Q9C5A9.pdb.gz	ATPBO_ARATH ATP synthase subunit beta-3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08680 PE=1 SV=1
6	AFDB:P17614	0.913	0.863	2.090E-83	560	0.732	0.691	P17614.pdb.gz	ATPBM_NICPL ATP synthase subunit beta, mitochondrial OS=Nicotiana plumbaginifolia OX=4092 GN=ATPB PE=1 SV=1
7	AFDB:P22068	0.892	0.899	2.090E-83	525	0.713	0.718	P22068.pdb.gz	ATPB_SCHPO ATP synthase subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp2 PE=1 SV=1
8	AFDB:P00830	0.884	0.915	1.395E-82	511	0.718	0.744	P00830.pdb.gz	ATPB_YEAST ATP synthase subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP2 PE=1 SV=2
9	AFDB:A0A1D8PKZ9	0.887	0.931	1.628E-81	504	0.709	0.744	A0A1D8PKZ9.pdb.gz	A0A1D8PKZ9_CANAL ATP synthase subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP2 PE=3 SV=1
10	AFDB:Q8T4C4	0.890	0.757	2.844E-81	622	0.688	0.585	Q8T4C4.pdb.gz	Q8T4C4_DROME ATP synthase subunit beta OS=Drosophila melanogaster OX=7227 GN=ATPsynbetaL PE=2 SV=1
11	PDB:2wpdE	0.871	0.972	2.166E-73	473	0.705	0.789	2wpdE.pdb.gz	Crystal Structure of the Mg.Adp-Inhibited State of the Yeast F1C10-ATP Synthase.
12	PDB:6f5dF	0.811	0.875	2.295E-69	488	0.595	0.645	6f5dF.pdb.gz	ATP synthase fromTrypanosoma bruceihas an elaborated canonical F1-domain and conventional catalytic sites.
13	PDB:1mabB	0.797	0.877	3.587E-69	477	0.883	0.979	1mabB.pdb.gz	The 2.8-A structure of rat liver F1-ATPase: configuration of a critical intermediate in ATP synthesis/hydrolysis.
14	PDB:7l1qF	0.780	0.869	5.023E-65	471	0.628	0.705	7l1qF.pdb.gz	The six steps of the complete F 1 -ATPase rotary catalytic cycle.
15	PDB:5t4oF	0.766	0.860	5.270E-52	466	0.628	0.712	5t4oF.pdb.gz	Cryo-EM structures of the autoinhibitedE. coliATP synthase in three rotational states.
16	PDB:6f5dA	0.697	0.703	4.561E-33	524	0.176	0.177	6f5dA.pdb.gz	ATP synthase fromTrypanosoma bruceihas an elaborated canonical F1-domain and conventional catalytic sites.
17	PDB:6oqsB	0.706	0.727	9.966E-33	513	0.210	0.216	6oqsB.pdb.gz	Cryo-EM structures provide insight into how E. coli F1FoATP synthase accommodates symmetry mismatch.
18	PDB:5ze9F	0.712	0.817	1.393E-32	456	0.202	0.235	5ze9F.pdb.gz	Metastable asymmetrical structure of a shaftless V1motor.
19	PDB:5b0oB	0.673	0.774	1.453E-31	455	0.208	0.242	5b0oB.pdb.gz	Insight into the flagella type III export revealed by the complex structure of the type III ATPase and its regulator
20	PDB:2wssA	0.730	0.756	5.249E-31	510	0.200	0.208	2wssA.pdb.gz	The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PKZ9	756	504	0.722	0.758	A0A1D8PKZ9_CANAL ATP synthase subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP2 PE=3 SV=1
2	H0YH81	655	362	0.650	0.950	H0YH81_HUMAN ATP synthase subunit beta (Fragment) OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=1
3	P00829	1025	528	0.966	0.968	ATPB_BOVIN ATP synthase subunit beta, mitochondrial OS=Bos taurus OX=9913 GN=ATP5F1B PE=1 SV=2
4	P00830	744	511	0.699	0.724	ATPB_YEAST ATP synthase subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP2 PE=1 SV=2
5	P06576	1061	529	1.000	1.000	ATPB_HUMAN ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3
6	P07677	647	473	0.624	0.698	ATPB_BACP3 ATP synthase subunit beta OS=Bacillus sp. (strain PS3) OX=2334 GN=atpD PE=1 SV=1
7	P0ABB4	660	460	0.631	0.726	ATPB_ECOLI ATP synthase subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=atpD PE=1 SV=2
8	P0C2Z7	646	498	0.637	0.677	ATPB_ORYSA ATP synthase subunit beta, chloroplastic OS=Oryza sativa OX=4530 GN=atpB PE=3 SV=1
9	P0C2Z8	646	498	0.637	0.677	ATPB_ORYSI ATP synthase subunit beta, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=atpB PE=3 SV=1
10	P10719	1018	529	0.957	0.957	ATPB_RAT ATP synthase subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5f1b PE=1 SV=2
11	P12085	646	498	0.637	0.677	ATPB_ORYSJ ATP synthase subunit beta, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=atpB PE=1 SV=2
12	P17614	770	560	0.739	0.698	ATPBM_NICPL ATP synthase subunit beta, mitochondrial OS=Nicotiana plumbaginifolia OX=4092 GN=ATPB PE=1 SV=1
13	P19366	647	498	0.645	0.685	ATPB_ARATH ATP synthase subunit beta, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpB PE=1 SV=2
14	P22068	750	525	0.705	0.710	ATPB_SCHPO ATP synthase subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp2 PE=1 SV=1
15	P26527	639	483	0.629	0.689	ATPB_SYNY3 ATP synthase subunit beta OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=atpD PE=3 SV=1
16	P46561	847	538	0.784	0.771	ATPB_CAEEL ATP synthase subunit beta, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=atp-2 PE=1 SV=2
17	P56480	1007	529	0.962	0.962	ATPB_MOUSE ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2
18	P83484	758	556	0.705	0.671	ATPBN_ARATH ATP synthase subunit beta-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08690 PE=1 SV=1
19	P9WPU5	567	486	0.543	0.591	ATPB_MYCTU ATP synthase subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=atpD PE=1 SV=1
20	Q01859	772	552	0.718	0.688	ATPBM_ORYSJ ATP synthase subunit beta, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=ATPB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	2.4e+02	13.5	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	3.5e+02	12.9	AAA ATPase domain
3	PF13245 AAA_19	4.1e+02	12.6	AAA domain
4	PF00005 ABC_tran	5.2e+02	12.5	ABC transporter
5	PF00006 ATP-synt_ab	6.3e-60	214.0	ATP synthase alpha/beta family, nucleotide-binding domain
6	PF02874 ATP-synt_ab_N	1.6e-18	78.3	ATP synthase alpha/beta family, beta-barrel domain
7	PF06745 ATPase	1.2e+02	13.4	KaiC
8	PF01637 ATPase_2	25	16.2	ATPase domain predominantly from Archaea
9	PF09848 DUF2075	7.8e+02	10.7	Schlafen group 3, DNA/RNA helicase domain
10	PF19150 DUF5832	5e+02	12.5	Family of unknown function (DUF5832)
11	PF05729 NACHT	1.3e+02	14.0	NACHT domain
12	PF00931 NB-ARC	66	14.1	NB-ARC domain
13	PF03193 RsgA_GTPase	77	14.6	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262030

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215375	0.999	ATP synthase subunit delta, mitochondrial
2	9606.ENSP00000290299	0.999	ATP synthase subunit O, mitochondrial
3	9606.ENSP00000292475	0.999	ATP synthase subunit f, mitochondrial
4	9606.ENSP00000301587	0.999	ATP synthase subunit d, mitochondrial
5	9606.ENSP00000349142	0.999	ATP synthase subunit gamma, mitochondrial
6	9606.ENSP00000354632	0.999	ATP synthase subunit a
7	9606.ENSP00000358737	0.999	ATP synthase F(0) complex subunit B1, mitochondrial
8	9606.ENSP00000381736	0.999	ATP synthase subunit alpha, mitochondrial
9	9606.ENSP00000389649	0.999	ATP synthase-coupling factor 6, mitochondrial
10	9606.ENSP00000243997	0.998	ATP synthase subunit epsilon, mitochondrial
11	9606.ENSP00000300688	0.998	ATP synthase subunit g, mitochondrial
12	9606.ENSP00000306003	0.998	ATP synthase subunit e, mitochondrial
13	9606.ENSP00000317159	0.998	Cytochrome c1, heme protein, mitochondrial
14	9606.ENSP00000377033	0.997	ATP synthase F(0) complex subunit C1, mitochondrial
15	9606.ENSP00000284727	0.995	ATP synthase F(0) complex subunit C3, mitochondrial
16	9606.ENSP00000342056	0.992	Citrate synthase, mitochondrial
17	9606.ENSP00000355265	0.992	ATP synthase protein 8
18	9606.ENSP00000216254	0.990	Aconitate hydratase, mitochondrial
19	9606.ENSP00000268379	0.990	Cytochrome b-c1 complex subunit 2, mitochondrial
20	9606.ENSP00000281456	0.987	ADP/ATP translocase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0003824	0.964	catalytic activity
GO:0140657	0.850	ATP-dependent activity
GO:0005215	0.814	transporter activity
GO:0097159	0.709	organic cyclic compound binding
GO:0022857	0.687	transmembrane transporter activity
GO:1901363	0.651	heterocyclic compound binding
GO:0022890	0.556	inorganic cation transmembrane transporter activity
GO:0008324	0.555	monoatomic cation transmembrane transporter activity
GO:0015399	0.447	primary active transmembrane transporter activity
GO:0036094	0.345	small molecule binding
GO:0042626	0.332	ATPase-coupled transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0008152	0.990	metabolic process
GO:0071704	0.984	organic substance metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0044238	0.976	primary metabolic process
GO:1901564	0.937	organonitrogen compound metabolic process
GO:0034641	0.937	cellular nitrogen compound metabolic process
GO:0044281	0.925	small molecule metabolic process
GO:1901360	0.888	organic cyclic compound metabolic process
GO:0032502	0.877	developmental process
GO:0006793	0.836	phosphorus metabolic process
GO:0006725	0.832	cellular aromatic compound metabolic process
GO:0032501	0.826	multicellular organismal process
GO:0046483	0.814	heterocycle metabolic process
GO:0006139	0.787	nucleobase-containing compound metabolic process
GO:0019637	0.786	organophosphate metabolic process
GO:0055086	0.773	nucleobase-containing small molecule metabolic process
GO:0006796	0.621	phosphate-containing compound metabolic process
GO:0065007	0.510	biological regulation
GO:0006753	0.508	nucleoside phosphate metabolic process
GO:0019693	0.477	ribose phosphate metabolic process
GO:0050789	0.461	regulation of biological process
GO:1901576	0.461	organic substance biosynthetic process
GO:0009117	0.426	nucleotide metabolic process
GO:0009259	0.394	ribonucleotide metabolic process
GO:0044271	0.388	cellular nitrogen compound biosynthetic process
GO:0072521	0.388	purine-containing compound metabolic process
GO:0009141	0.386	nucleoside triphosphate metabolic process
GO:0050794	0.380	regulation of cellular process
GO:0009150	0.367	purine ribonucleotide metabolic process
GO:0050896	0.312	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005739	0.998	mitochondrion
GO:0032991	0.994	protein-containing complex
GO:0031090	0.974	organelle membrane
GO:0098800	0.964	inner mitochondrial membrane protein complex
GO:0016469	0.939	proton-transporting two-sector ATPase complex
GO:0045259	0.930	proton-transporting ATP synthase complex
GO:0070013	0.897	intracellular organelle lumen
GO:0005753	0.896	mitochondrial proton-transporting ATP synthase complex
GO:0005829	0.585	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.447	Translocases.

[back to server]