StarFunc result for job id P06681

User Input

>input (752 residues)
MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA
SRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG
FILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSN
LVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKES
LGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFAS
EPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGME
TMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRNDYLDIYAIGVGKLDVDW
RELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPW
HVTIKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVI
SPGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTC
RDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVT
DQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRS
KVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06681	1.000	1.000	0.000	752	1.000	1.000	P06681.pdb.gz	CO2_HUMAN Complement C2 OS=Homo sapiens OX=9606 GN=C2 PE=1 SV=2
2	AFDB:P21180	0.615	0.610	0.000	760	0.758	0.750	P21180.pdb.gz	CO2_MOUSE Complement C2 OS=Mus musculus OX=10090 GN=C2 PE=1 SV=2
3	AFDB:Q6MG73	0.963	0.956	0.000	758	0.773	0.766	Q6MG73.pdb.gz	Q6MG73_RAT Complement C2 OS=Rattus norvegicus OX=10116 GN=C2 PE=2 SV=1
4	AFDB:P00751	0.566	0.559	2.586E-85	764	0.390	0.384	P00751.pdb.gz	CFAB_HUMAN Complement factor B OS=Homo sapiens OX=9606 GN=CFB PE=1 SV=2
5	AFDB:G3V615	0.616	0.609	1.692E-84	763	0.396	0.391	G3V615.pdb.gz	G3V615_RAT C3/C5 convertase OS=Rattus norvegicus OX=10116 GN=Cfb PE=4 SV=1
6	AFDB:Q7TP05	0.543	0.393	4.654E-83	1116	0.453	0.306	Q7TP05.pdb.gz	Q7TP05_RAT C3/C5 convertase OS=Rattus norvegicus OX=10116 PE=2 SV=1
7	AFDB:A0A0U1RRP9	0.556	0.401	4.241E-82	1115	0.453	0.306	A0A0U1RRP9.pdb.gz	A0A0U1RRP9_RAT Complement C2 OS=Rattus norvegicus OX=10116 GN=Cfb PE=1 SV=2
8	AFDB:F1R886	0.602	0.596	6.581E-79	761	0.355	0.351	F1R886.pdb.gz	F1R886_DANRE Complement C2 OS=Danio rerio OX=7955 GN=Bf-1 PE=1 SV=1
9	PDB:2xwbF	0.493	0.517	1.367E-77	714	0.382	0.402	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
10	AFDB:A0A2R8QKR9	0.544	0.544	1.499E-72	751	0.328	0.329	A0A2R8QKR9.pdb.gz
11	AFDB:P28175	0.270	0.203	5.310E-22	1019	0.191	0.141	P28175.pdb.gz	CFC_TACTR Clotting factor C OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
12	PDB:1a0lA	0.253	0.710	1.020E-15	244	0.085	0.262	1a0lA.pdb.gz	Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
13	PDB:6i44A	0.252	0.314	2.378E-14	594	0.082	0.104	6i44A.pdb.gz	Plasma kallikrein structure reveals apple domain disc rotated conformation compared to factor XI.
14	PDB:5i25A	0.248	0.309	1.393E-13	596	0.093	0.117	5i25A.pdb.gz	A novel DFP tripeptide motif interacts with the coagulation factor XI apple 2 domain.
15	PDB:1tgsZ	0.229	0.709	3.371E-13	225	0.069	0.231	1tgsZ.pdb.gz	Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.
16	PDB:6qfgA	0.238	0.743	3.978E-13	223	0.082	0.278	6qfgA.pdb.gz	Evaluation of a crystallographic surrogate for kallikrein 5 in the discovery of novel inhibitors for Netherton syndrome.
17	PDB:4bnrA	0.237	0.695	4.443E-13	237	0.064	0.203	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
18	PDB:1fiwA	0.245	0.654	6.912E-13	260	0.074	0.215	1fiwA.pdb.gz	Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
19	PDB:1cgiE	0.242	0.693	8.621E-13	245	0.073	0.224	1cgiE.pdb.gz
20	PDB:6ahsA	0.222	0.690	1.868E-12	224	0.076	0.254	6ahsA.pdb.gz	Discovery and structure-activity relationship of imidazolinylindole derivatives as kallikrein 7 inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MKF9	0.0	971	621	0.622	0.754	A0A096MKF9_RAT Complement C2 OS=Rattus norvegicus OX=10116 GN=Cfb PE=1 SV=2
2	A0A0U1RRP9	0.0	686	502	0.435	0.651	A0A0U1RRP9_RAT Complement C2 OS=Rattus norvegicus OX=10116 GN=Cfb PE=1 SV=2
3	A0A8J8XKZ6	0.0	1185	774	0.763	0.742	A0A8J8XKZ6_RAT Complement C2 OS=Rattus norvegicus OX=10116 GN=C2 PE=1 SV=1
4	A0A8J8YKQ8	0.0	1167	798	0.762	0.718	A0A8J8YKQ8_RAT Complement C2 OS=Rattus norvegicus OX=10116 GN=C2 PE=1 SV=1
5	P06681	0.0	1570	752	1.000	1.000	CO2_HUMAN Complement C2 OS=Homo sapiens OX=9606 GN=C2 PE=1 SV=2
6	P21180	0.0	1161	760	0.751	0.743	CO2_MOUSE Complement C2 OS=Mus musculus OX=10090 GN=C2 PE=1 SV=2
7	Q6MG73	0.0	1185	758	0.763	0.757	Q6MG73_RAT Complement C2 OS=Rattus norvegicus OX=10116 GN=C2 PE=2 SV=1
8	P04186	9.16e-179	532	761	0.395	0.390	CFAB_MOUSE Complement factor B OS=Mus musculus OX=10090 GN=Cfb PE=1 SV=2
9	G3V615	5.10e-177	527	763	0.392	0.387	G3V615_RAT C3/C5 convertase OS=Rattus norvegicus OX=10116 GN=Cfb PE=4 SV=1
10	Q6MG74	6.92e-177	527	761	0.392	0.388	Q6MG74_RAT C3/C5 convertase OS=Rattus norvegicus OX=10116 GN=Cfb PE=2 SV=1
11	P00751	9.00e-175	521	764	0.400	0.394	CFAB_HUMAN Complement factor B OS=Homo sapiens OX=9606 GN=CFB PE=1 SV=2
12	Q7TP05	7.03e-158	489	1116	0.360	0.243	Q7TP05_RAT C3/C5 convertase OS=Rattus norvegicus OX=10116 PE=2 SV=1
13	F1R886	1.42e-155	472	761	0.371	0.367	F1R886_DANRE Complement C2 OS=Danio rerio OX=7955 GN=Bf-1 PE=1 SV=1
14	F1QFC2	1.41e-153	467	760	0.371	0.367	F1QFC2_DANRE Complement C2 OS=Danio rerio OX=7955 GN=Bf-1 PE=1 SV=3
15	A2VD28	7.19e-139	429	751	0.342	0.342	A2VD28_DANRE Complement C2 OS=Danio rerio OX=7955 GN=fc04c04 PE=1 SV=1
16	P81475	6.61e-47	169	250	0.132	0.396	CFBL_CHICK Complement factor B-like protease (Fragment) OS=Gallus gallus OX=9031 PE=1 SV=1
17	A2AVA0	3.26e-21	102	3567	0.088	0.019	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
18	Q96PZ7	1.85e-18	93.2	3564	0.089	0.019	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
19	Q923L3	2.05e-18	93.2	3564	0.080	0.017	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
20	Q4LDE5	2.04e-17	90.1	3571	0.084	0.018	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01607 CBM_14	8.9e+02	11.5	Chitin binding Peritrophin-A domain
2	PF09342 DUF1986	0.34	22.7	Domain of unknown function (DUF1986)
3	PF02793 HRM	0.43	22.2	Hormone receptor domain
4	PF00084 Sushi	1.1e-16	72.3	Sushi repeat (SCR repeat)
5	PF00089 Trypsin	1e-26	105.7	Trypsin
6	PF13365 Trypsin_2	34	16.8	Trypsin-like peptidase domain
7	PF00092 VWA	1.9e-32	124.4	von Willebrand factor type A domain
8	PF13519 VWA_2	4e-06	38.8	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299367

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223642	0.967	Complement C5
2	9606.ENSP00000245907	0.967	Complement C3
3	9606.ENSP00000415941	0.966	Complement C4-B
4	9606.ENSP00000438615	0.952	Complement C1r subcomponent
5	9606.ENSP00000396688	0.948	Complement C4-A
6	9606.ENSP00000363079	0.942	Mannose-binding protein C
7	9606.ENSP00000363770	0.939	Complement C1q subcomponent subunit C
8	9606.ENSP00000296280	0.935	Mannan binding lectin serine peptidase 1
9	9606.ENSP00000313967	0.935	Complement C1q subcomponent subunit B
10	9606.ENSP00000291744	0.934	Ficolin-2
11	9606.ENSP00000270879	0.930	Ficolin-3
12	9606.ENSP00000385035	0.930	Complement C1s subcomponent
13	9606.ENSP00000363773	0.923	Complement C1q subcomponent subunit A
14	9606.ENSP00000383690	0.921	Mannan-binding lectin serine protease 2
15	9606.ENSP00000360871	0.918	Ficolin-1
16	9606.ENSP00000411770	0.918	Collectin-11
17	9606.ENSP00000378130	0.910	Complement factor I
18	9606.ENSP00000332723	0.908	Collectin-10
19	9606.ENSP00000431254	0.902	Immunoglobulin lambda like polypeptide 5
20	9606.ENSP00000478725	0.900	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.727	catalytic activity
GO:0016787	0.654	hydrolase activity
GO:0008233	0.546	peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050789	0.996	regulation of biological process
GO:0002682	0.991	regulation of immune system process
GO:0048583	0.986	regulation of response to stimulus
GO:0048518	0.986	positive regulation of biological process
GO:0050776	0.981	regulation of immune response
GO:0048584	0.981	positive regulation of response to stimulus
GO:0002376	0.979	immune system process
GO:0006956	0.971	complement activation
GO:0009605	0.955	response to external stimulus
GO:0050794	0.853	regulation of cellular process
GO:0044419	0.671	biological process involved in interspecies interaction between organisms
GO:0051707	0.626	response to other organism
GO:0042221	0.515	response to chemical
GO:0007584	0.454	response to nutrient
GO:0060627	0.346	regulation of vesicle-mediated transport
GO:0009987	0.333	cellular process
GO:0050764	0.301	regulation of phagocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0031982	0.917	vesicle
GO:1903561	0.839	extracellular vesicle
GO:0070062	0.834	extracellular exosome
GO:0071944	0.345	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.654	Hydrolases.
EC:3.4.-.-	0.546	Acting on peptide bonds (peptidases).

[back to server]