StarFunc result for job id P06702

User Input

>input (114 residues)
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06702	1.000	1.000	1.412E-20	114	1.000	1.000	P06702.pdb.gz	S10A9_HUMAN Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1
2	AFDB:P50116	0.870	0.878	8.847E-14	113	0.614	0.619	P50116.pdb.gz	S10A9_RAT Protein S100-A9 OS=Rattus norvegicus OX=10116 GN=S100a9 PE=1 SV=3
3	PDB:7ui5A	0.667	0.667	1.313E-13	114	0.982	0.982	7ui5A.pdb.gz	Evolution avoids a pathological stabilizing interaction in the immune protein S100A9.
4	AFDB:P31725	0.889	0.896	1.864E-13	113	0.579	0.584	P31725.pdb.gz	S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
5	PDB:6zdyA	0.833	0.877	1.154E-12	108	0.553	0.583	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
6	AFDB:P80310	0.782	0.966	9.194E-9	92	0.368	0.457	P80310.pdb.gz	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
7	AFDB:P79105	0.778	0.960	1.108E-8	92	0.360	0.446	P79105.pdb.gz	S10AC_BOVIN Protein S100-A12 OS=Bos taurus OX=9913 GN=S100A12 PE=1 SV=3
8	AFDB:P80511	0.780	0.962	2.193E-8	92	0.377	0.467	P80511.pdb.gz	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
9	AFDB:A0A0S2Z4C5	0.738	0.909	5.232E-8	92	0.307	0.380	A0A0S2Z4C5.pdb.gz	A0A0S2Z4C5_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100B PE=2 SV=1
10	AFDB:Q5T7Y6	0.790	0.616	9.737E-8	147	0.307	0.238	Q5T7Y6.pdb.gz	Q5T7Y6_HUMAN Protein S100 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=1
11	AFDB:P29034	0.789	0.910	1.928E-7	98	0.272	0.316	P29034.pdb.gz	S10A2_HUMAN Protein S100-A2 OS=Homo sapiens OX=9606 GN=S100A2 PE=1 SV=3
12	AFDB:A0A060WYU6	0.743	0.875	2.978E-7	96	0.333	0.396	A0A060WYU6.pdb.gz	A0A060WYU6_ONCMY Protein S100 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00052820001 PE=3 SV=1
13	PDB:5csnA	0.726	0.871	9.313E-7	94	0.307	0.372	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
14	PDB:5hloC	0.709	0.859	1.438E-6	93	0.228	0.280	5hloC.pdb.gz	Crystal structure of human S100A8 in complex with zinc and calcium.
15	PDB:2lucA	0.760	0.820	1.531E-6	105	0.289	0.314	2lucA.pdb.gz
16	PDB:7psqG	0.750	0.789	1.733E-6	108	0.263	0.278	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
17	PDB:1k96A	0.716	0.909	2.364E-6	89	0.246	0.315	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
18	PDB:2wc8D	0.605	0.725	3.031E-6	93	0.377	0.462	2wc8D.pdb.gz	The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
19	PDB:2kayA	0.734	0.897	4.981E-6	92	0.254	0.315	2kayA.pdb.gz	Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
20	PDB:2k2fA	0.664	0.794	2.835E-5	93	0.298	0.366	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06702	5.13e-82	237	114	1.000	1.000	S10A9_HUMAN Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1
2	P50116	6.96e-43	138	113	0.605	0.611	S10A9_RAT Protein S100-A9 OS=Rattus norvegicus OX=10116 GN=S100a9 PE=1 SV=3
3	P31725	6.75e-40	130	113	0.561	0.566	S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
4	P80310	2.31e-22	85.5	92	0.368	0.457	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
5	P79105	7.01e-22	84.3	92	0.360	0.446	S10AC_BOVIN Protein S100-A12 OS=Bos taurus OX=9913 GN=S100A12 PE=1 SV=3
6	P80511	1.62e-21	83.6	92	0.377	0.467	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
7	P02638	9.28e-17	71.2	92	0.307	0.380	S100B_BOVIN Protein S100-B OS=Bos taurus OX=9913 GN=S100B PE=1 SV=2
8	P25815	1.84e-16	70.5	95	0.298	0.358	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
9	A0A0S2Z4C5	6.56e-16	69.3	92	0.307	0.380	A0A0S2Z4C5_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100B PE=2 SV=1
10	P04271	6.56e-16	69.3	92	0.307	0.380	S100B_HUMAN Protein S100-B OS=Homo sapiens OX=9606 GN=S100B PE=1 SV=2
11	A0A060WZ60	6.80e-16	69.3	96	0.325	0.385	A0A060WZ60_ONCMY Protein S100 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00063160001 PE=3 SV=1
12	P50114	7.89e-16	68.9	92	0.307	0.380	S100B_MOUSE Protein S100-B OS=Mus musculus OX=10090 GN=S100b PE=1 SV=2
13	P04631	2.66e-15	67.4	92	0.298	0.370	S100B_RAT Protein S100-B OS=Rattus norvegicus OX=10116 GN=S100b PE=1 SV=2
14	P02639	3.04e-14	65.1	94	0.289	0.351	S10A1_BOVIN Protein S100-A1 OS=Bos taurus OX=9913 GN=S100A1 PE=1 SV=2
15	P35467	3.04e-14	65.1	94	0.298	0.362	S10A1_RAT Protein S100-A1 OS=Rattus norvegicus OX=10116 GN=S100a1 PE=1 SV=3
16	A0A0S2Z4H2	5.95e-14	64.3	94	0.289	0.351	A0A0S2Z4H2_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100A1 PE=2 SV=1
17	P23297	5.95e-14	64.3	94	0.289	0.351	S10A1_HUMAN Protein S100-A1 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=2
18	Q5T7Y6	5.99e-14	65.5	147	0.289	0.224	Q5T7Y6_HUMAN Protein S100 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=1
19	Q5XJJ5	6.57e-14	64.3	102	0.289	0.324	Q5XJJ5_DANRE Protein S100 OS=Danio rerio OX=7955 GN=zgc:101880 PE=2 SV=1
20	P31949	1.17e-13	63.5	105	0.289	0.314	S10AB_HUMAN Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.052	24.2	EF hand
2	PF12763 EF-hand_4	22	16.4	Cytoskeletal-regulatory complex EF hand
3	PF13405 EF-hand_6	44	15.3	EF-hand domain
4	PF13499 EF-hand_7	0.0018	30.0	EF-hand domain pair
5	PF13833 EF-hand_8	31	15.8	EF-hand domain pair
6	PF18109 Fer4_24	2.4e+02	13.3	Ferredoxin I 4Fe-4S cluster domain
7	PF04778 LMP	51	15.2	LMP repeated region
8	PF10591 SPARC_Ca_bdg	95	14.8	Secreted protein acidic and rich in cysteine Ca binding region
9	PF01023 S_100	3.9e-17	72.9	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357722	0.999	Protein S100-A8
2	9606.ENSP00000357726	0.995	Protein S100-A12
3	9606.ENSP00000363089	0.989	Toll-like receptor 4
4	9606.ENSP00000284818	0.962	Lymphocyte antigen 96
5	9606.ENSP00000358997	0.941	Interleukin-1 receptor-associated kinase 1
6	9606.ENSP00000401399	0.935	Myeloid differentiation primary response protein MyD88
7	9606.ENSP00000376445	0.904	Toll/interleukin-1 receptor domain-containing adapter protein
8	9606.ENSP00000356505	0.876	Neutrophil cytosol factor 2
9	9606.ENSP00000296511	0.845	Annexin A5
10	9606.ENSP00000229239	0.765	Glyceraldehyde-3-phosphate dehydrogenase
11	9606.ENSP00000367851	0.761	Cytochrome b-245 heavy chain
12	9606.ENSP00000357123	0.741	Myeloid cell nuclear differentiation antigen
13	9606.ENSP00000380334	0.736	Neutrophil cytosol factor 4
14	9606.ENSP00000250092	0.715	Macrosialin
15	9606.ENSP00000289473	0.712	Neutrophil cytosol factor 1
16	9606.ENSP00000352071	0.709	Scavenger receptor cysteine-rich type 1 protein M130
17	9606.ENSP00000365569	0.703	Flotillin-1
18	9606.ENSP00000264474	0.702	Cystatin-A
19	9606.ENSP00000356946	0.693	Low affinity immunoglobulin gamma Fc region receptor III-A
20	9606.ENSP00000260010	0.671	Toll-like receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046914	1.000	transition metal ion binding
GO:0005509	1.000	calcium ion binding
GO:0008289	0.999	lipid binding
GO:0015631	0.992	tubulin binding
GO:0008270	0.991	zinc ion binding
GO:0005102	0.958	signaling receptor binding
GO:0036041	0.889	long-chain fatty acid binding
GO:0042802	0.887	identical protein binding
GO:0008017	0.886	microtubule binding
GO:0050786	0.416	RAGE receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.973	response to stimulus
GO:0009987	0.973	cellular process
GO:0050794	0.968	regulation of cellular process
GO:0048518	0.966	positive regulation of biological process
GO:0009605	0.964	response to external stimulus
GO:0042221	0.955	response to chemical
GO:0009607	0.954	response to biotic stimulus
GO:0048522	0.945	positive regulation of cellular process
GO:0006950	0.926	response to stress
GO:0043207	0.905	response to external biotic stimulus
GO:0051707	0.904	response to other organism
GO:0051716	0.891	cellular response to stimulus
GO:0019222	0.885	regulation of metabolic process
GO:0006952	0.882	defense response
GO:0071704	0.881	organic substance metabolic process
GO:0060255	0.881	regulation of macromolecule metabolic process
GO:0048583	0.876	regulation of response to stimulus
GO:0048584	0.867	positive regulation of response to stimulus
GO:0044238	0.861	primary metabolic process
GO:0010468	0.852	regulation of gene expression
GO:0044237	0.844	cellular metabolic process
GO:0051171	0.844	regulation of nitrogen compound metabolic process
GO:0080090	0.841	regulation of primary metabolic process
GO:0002376	0.829	immune system process
GO:0006959	0.822	humoral immune response
GO:0031323	0.822	regulation of cellular metabolic process
GO:0006954	0.820	inflammatory response
GO:1902533	0.820	positive regulation of intracellular signal transduction
GO:0006807	0.812	nitrogen compound metabolic process
GO:0051090	0.794	regulation of DNA-binding transcription factor activity
GO:0051247	0.791	positive regulation of protein metabolic process
GO:0009617	0.778	response to bacterium
GO:0043170	0.774	macromolecule metabolic process
GO:0043085	0.774	positive regulation of catalytic activity
GO:0051091	0.765	positive regulation of DNA-binding transcription factor activity
GO:0032101	0.763	regulation of response to external stimulus
GO:0050900	0.761	leukocyte migration
GO:0042742	0.760	defense response to bacterium
GO:0019730	0.748	antimicrobial humoral response
GO:0051092	0.747	positive regulation of NF-kappaB transcription factor activity
GO:0080134	0.744	regulation of response to stress
GO:0006935	0.738	chemotaxis
GO:0023052	0.732	signaling
GO:0060326	0.731	cell chemotaxis
GO:0007154	0.729	cell communication
GO:0030595	0.717	leukocyte chemotaxis
GO:0061844	0.707	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0052547	0.703	regulation of peptidase activity
GO:1901564	0.701	organonitrogen compound metabolic process
GO:0051179	0.695	localization
GO:0051345	0.690	positive regulation of hydrolase activity
GO:0019538	0.679	protein metabolic process
GO:0052548	0.672	regulation of endopeptidase activity
GO:0036211	0.657	protein modification process
GO:0097529	0.654	myeloid leukocyte migration
GO:0018198	0.646	peptidyl-cysteine modification
GO:0010952	0.645	positive regulation of peptidase activity
GO:0097530	0.609	granulocyte migration
GO:0098609	0.597	cell-cell adhesion
GO:0030593	0.587	neutrophil chemotaxis
GO:0051128	0.566	regulation of cellular component organization
GO:0032103	0.557	positive regulation of response to external stimulus
GO:0007159	0.553	leukocyte cell-cell adhesion
GO:0051235	0.547	maintenance of location
GO:0006873	0.538	intracellular monoatomic ion homeostasis
GO:0098771	0.536	inorganic ion homeostasis
GO:0051238	0.532	sequestering of metal ion
GO:0031347	0.479	regulation of defense response
GO:0031349	0.442	positive regulation of defense response
GO:0030003	0.438	intracellular monoatomic cation homeostasis
GO:0032501	0.403	multicellular organismal process
GO:0051641	0.393	cellular localization
GO:0051239	0.361	regulation of multicellular organismal process
GO:0048519	0.332	negative regulation of biological process
GO:0007165	0.331	signal transduction
GO:0050727	0.327	regulation of inflammatory response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0012505	0.997	endomembrane system
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005576	0.996	extracellular region
GO:0005886	0.996	plasma membrane
GO:0031982	0.992	vesicle
GO:0031410	0.981	cytoplasmic vesicle
GO:0070013	0.980	intracellular organelle lumen
GO:0005829	0.950	cytosol
GO:0005615	0.941	extracellular space
GO:0005634	0.917	nucleus
GO:0030141	0.887	secretory granule
GO:0031983	0.881	vesicle lumen
GO:0070062	0.831	extracellular exosome
GO:0060205	0.829	cytoplasmic vesicle lumen
GO:0043232	0.752	intracellular non-membrane-bounded organelle
GO:0034774	0.589	secretory granule lumen
GO:0031981	0.536	nuclear lumen
GO:0005654	0.522	nucleoplasm
GO:0062023	0.519	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]