StarFunc result for job id P06727

User Input

>input (396 residues)
MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEV
SQKIGDNLRELQQRLEPYADQLRTQVSTQAEQLRRQLTPYAQRMERVLRENADSLQASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEG
LTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQV
EEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06727	1.000	1.000	2.388E-44	396	1.000	1.000	P06727.pdb.gz	APOA4_HUMAN Apolipoprotein A-IV OS=Homo sapiens OX=9606 GN=APOA4 PE=1 SV=4
2	AFDB:P02651	0.603	0.610	3.474E-27	391	0.616	0.624	P02651.pdb.gz	APOA4_RAT Apolipoprotein A-IV OS=Rattus norvegicus OX=10116 GN=Apoa4 PE=1 SV=2
3	AFDB:P06728	0.685	0.687	7.485E-26	395	0.616	0.618	P06728.pdb.gz	APOA4_MOUSE Apolipoprotein A-IV OS=Mus musculus OX=10090 GN=Apoa4 PE=1 SV=3
4	AFDB:Q8C7G5	0.359	0.385	8.298E-4	368	0.240	0.258	Q8C7G5.pdb.gz	APOA5_MOUSE Apolipoprotein A-V OS=Mus musculus OX=10090 GN=Apoa5 PE=1 SV=1
5	AFDB:Q6Q788	0.339	0.365	2.592E-3	366	0.235	0.254	Q6Q788.pdb.gz	APOA5_HUMAN Apolipoprotein A-V OS=Homo sapiens OX=9606 GN=APOA5 PE=1 SV=1
6	AFDB:P08250	0.189	0.270	7.705E-3	264	0.179	0.269	P08250.pdb.gz	APOA1_CHICK Apolipoprotein A-I OS=Gallus gallus OX=9031 GN=APOA1 PE=1 SV=2
7	AFDB:Q6ZMI0	0.124	0.081	1.541E-2	780	0.184	0.094	Q6ZMI0.pdb.gz	PPR21_HUMAN Protein phosphatase 1 regulatory subunit 21 OS=Homo sapiens OX=9606 GN=PPP1R21 PE=1 SV=1
8	AFDB:Q09857	0.162	0.074	1.702E-2	1067	0.152	0.056	Q09857.pdb.gz	USO1_SCHPO Intracellular protein transport protein uso1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uso1 PE=3 SV=3
9	AFDB:Q00623	0.171	0.244	2.529E-2	264	0.154	0.231	Q00623.pdb.gz	APOA1_MOUSE Apolipoprotein A-I OS=Mus musculus OX=10090 GN=Apoa1 PE=1 SV=2
10	AFDB:Q3UH98	0.118	0.067	2.529E-2	833	0.081	0.038	Q3UH98.pdb.gz	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
11	PDB:6xz6A	0.173	0.271	8.059E-2	213	0.078	0.146	6xz6A.pdb.gz
12	PDB:6q0xA	0.191	0.201	1.140E-1	373	0.078	0.083	6q0xA.pdb.gz
13	PDB:6ikoA	0.155	0.190	1.460E-1	303	0.076	0.099	6ikoA.pdb.gz
14	PDB:1yviA	0.130	0.305	1.612E-1	140	0.066	0.186	1yviA.pdb.gz
15	PDB:6sueA	0.130	0.032	1.694E-1	2292	0.083	0.014	6sueA.pdb.gz
16	PDB:4im0A	0.141	0.094	2.065E-1	619	0.083	0.053	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
17	PDB:4o9yA	0.128	0.029	2.517E-1	2490	0.096	0.015	4o9yA.pdb.gz
18	PDB:4q25A	0.139	0.221	2.779E-1	211	0.058	0.109	4q25A.pdb.gz
19	PDB:3hajA	0.113	0.145	4.131E-1	286	0.086	0.119	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
20	PDB:7p5jA	0.150	0.149	4.340E-1	399	0.061	0.060	7p5jA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06727	0.0	791	396	1.000	1.000	APOA4_HUMAN Apolipoprotein A-IV OS=Homo sapiens OX=9606 GN=APOA4 PE=1 SV=4
2	P02651	4.09e-172	488	391	0.586	0.593	APOA4_RAT Apolipoprotein A-IV OS=Rattus norvegicus OX=10116 GN=Apoa4 PE=1 SV=2
3	P06728	4.40e-167	475	395	0.573	0.575	APOA4_MOUSE Apolipoprotein A-IV OS=Mus musculus OX=10090 GN=Apoa4 PE=1 SV=3
4	P08250	2.72e-29	116	264	0.194	0.292	APOA1_CHICK Apolipoprotein A-I OS=Gallus gallus OX=9031 GN=APOA1 PE=1 SV=2
5	Q6Q788	5.80e-27	112	366	0.247	0.268	APOA5_HUMAN Apolipoprotein A-V OS=Homo sapiens OX=9606 GN=APOA5 PE=1 SV=1
6	Q8C7G5	1.61e-24	105	368	0.250	0.269	APOA5_MOUSE Apolipoprotein A-V OS=Mus musculus OX=10090 GN=Apoa5 PE=1 SV=1
7	O42363	1.46e-21	95.1	262	0.162	0.244	APOA1_DANRE Apolipoprotein A-I OS=Danio rerio OX=7955 GN=apoa1 PE=1 SV=1
8	P09809	3.40e-21	94.4	266	0.162	0.241	APOA1_RABIT Apolipoprotein A-I OS=Oryctolagus cuniculus OX=9986 GN=APOA1 PE=1 SV=2
9	P04639	9.69e-21	92.8	259	0.179	0.274	APOA1_RAT Apolipoprotein A-I OS=Rattus norvegicus OX=10116 GN=Apoa1 PE=1 SV=2
10	Q9QUH3	1.62e-20	94.4	367	0.225	0.243	APOA5_RAT Apolipoprotein A-V OS=Rattus norvegicus OX=10116 GN=Apoa5 PE=1 SV=1
11	P02647	2.49e-20	92.0	267	0.172	0.255	APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens OX=9606 GN=APOA1 PE=1 SV=1
12	P02650	1.79e-19	90.5	312	0.192	0.244	APOE_RAT Apolipoprotein E OS=Rattus norvegicus OX=10116 GN=Apoe PE=1 SV=2
13	P08226	3.18e-19	89.7	311	0.187	0.238	APOE_MOUSE Apolipoprotein E OS=Mus musculus OX=10090 GN=Apoe PE=1 SV=2
14	P18648	7.54e-18	84.7	265	0.157	0.234	APOA1_PIG Apolipoprotein A-I OS=Sus scrofa OX=9823 GN=APOA1 PE=1 SV=4
15	Q00623	2.40e-17	83.6	264	0.162	0.242	APOA1_MOUSE Apolipoprotein A-I OS=Mus musculus OX=10090 GN=Apoa1 PE=1 SV=2
16	O57523	4.50e-16	79.7	262	0.162	0.244	APA11_ONCMY Apolipoprotein A-I-1 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
17	E3TE55	1.12e-13	72.8	258	0.149	0.229	E3TE55_ICTPU Apolipoprotein A-I OS=Ictalurus punctatus OX=7998 GN=APOA1 PE=2 SV=1
18	P02649	1.93e-13	72.8	317	0.152	0.189	APOE_HUMAN Apolipoprotein E OS=Homo sapiens OX=9606 GN=APOE PE=1 SV=1
19	G5BQH5	1.10e-09	60.8	264	0.134	0.201	APOA1_HETGA Apolipoprotein A-I OS=Heterocephalus glaber OX=10181 GN=Apoa1 PE=1 SV=2
20	Q98SI3	1.87e-08	55.8	174	0.101	0.230	Q98SI3_CYPCA Apolipoprotein A-I (Fragment) OS=Cyprinus carpio OX=7962 GN=apoA1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08900 AcaB	0.00011	33.6	Transcriptional regulator AcaB
2	PF01594 AI-2E_transport	2.2e+02	12.4	AI-2E family transporter
3	PF05778 Apo-CIII	5	18.1	Apolipoprotein CIII (Apo-CIII)
4	PF04711 ApoA-II	4.4	19.1	Apolipoprotein A-II (ApoA-II)
5	PF04691 ApoC-I	7.9e+02	11.3	Apolipoprotein C-I (ApoC-1)
6	PF01442 Apolipoprotein	9.6e-62	219.7	Apolipoprotein A1/A4/E domain
7	PF07464 ApoLp-III	2.3e-07	42.5	Apolipophorin-III precursor (apoLp-III)
8	PF09769 ApoO	4	18.8	Apolipoprotein O
9	PF04513 Baculo_PEP_C	1.5e-06	39.8	Baculovirus polyhedron envelope protein, PEP, C terminus
10	PF10079 BshC	13	16.0	Bacillithiol biosynthesis BshC
11	PF05388 Carbpep_Y_N	24	16.6	Carboxypeptidase Y pro-peptide
12	PF07798 CCDC90-like	26	16.2	Coiled-coil domain-containing protein 90-like
13	PF01544 CorA	65	14.3	CorA-like Mg2+ transporter protein
14	PF07889 DUF1664	26	16.3	Protein of unknown function (DUF1664)
15	PF08902 DUF1848	4.9e+02	11.9	Domain of unknown function (DUF1848)
16	PF19508 DUF6042	1.3e+02	13.6	Family of unknown function (DUF6042)
17	PF19903 DUF6376	29	16.4	Family of unknown function (DUF6376)
18	PF05957 DUF883	7.6e+02	11.4	DUF883 N-terminal domain
19	PF02601 Exonuc_VII_L	24	16.0	Exonuclease VII, large subunit
20	PF19745 FUT8_N_cat	90	13.3	Alpha-(1,6)-fucosyltransferase N- and catalytic domains

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350425

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227667	0.984	Apolipoprotein C-III
2	9606.ENSP00000233242	0.981	Apolipoprotein B-100
3	9606.ENSP00000078445	0.969	Cyclic AMP-responsive element-binding protein 3-like protein 3
4	9606.ENSP00000321334	0.968	Apolipoprotein(a)
5	9606.ENSP00000427679	0.962	Microsomal triglyceride transfer protein large subunit
6	9606.ENSP00000309757	0.956	Lipoprotein lipase
7	9606.ENSP00000466775	0.953	Apolipoprotein C-II
8	9606.ENSP00000373328	0.945	Cell death activator CIDE-3
9	9606.ENSP00000356969	0.939	Apolipoprotein A-II
10	9606.ENSP00000445002	0.937	Apolipoprotein A-V
11	9606.ENSP00000454071	0.937	Low-density lipoprotein receptor
12	9606.ENSP00000385432	0.927	GTP-binding protein SAR1b
13	9606.ENSP00000471477	0.924	Fibroblast growth factor 21
14	9606.ENSP00000480053	0.923	Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
15	9606.ENSP00000263816	0.914	Low-density lipoprotein receptor-related protein 2
16	9606.ENSP00000236850	0.913	Apolipoprotein A-I
17	9606.ENSP00000303634	0.912	Low-density lipoprotein receptor-related protein 8
18	9606.ENSP00000327801	0.911	Protein disulfide-isomerase
19	9606.ENSP00000243077	0.909	Prolow-density lipoprotein receptor-related protein 1
20	9606.ENSP00000205948	0.904	Beta-2-glycoprotein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0120020	0.999	cholesterol transfer activity
GO:0008047	0.998	enzyme activator activity
GO:0042803	0.998	protein homodimerization activity
GO:0016209	0.997	antioxidant activity
GO:0031210	0.997	phosphatidylcholine binding
GO:0005507	0.996	copper ion binding
GO:0060228	0.977	phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0005102	0.311	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.992	regulation of biological process
GO:0071704	0.988	organic substance metabolic process
GO:0050896	0.987	response to stimulus
GO:0044238	0.983	primary metabolic process
GO:0010876	0.978	lipid localization
GO:0032374	0.978	regulation of cholesterol transport
GO:0016043	0.972	cellular component organization
GO:0050794	0.965	regulation of cellular process
GO:0032501	0.946	multicellular organismal process
GO:0006950	0.926	response to stress
GO:0006869	0.922	lipid transport
GO:0044237	0.921	cellular metabolic process
GO:0019222	0.908	regulation of metabolic process
GO:0048518	0.903	positive regulation of biological process
GO:0048519	0.901	negative regulation of biological process
GO:1901615	0.899	organic hydroxy compound metabolic process
GO:0051239	0.887	regulation of multicellular organismal process
GO:0010033	0.886	response to organic substance
GO:0055088	0.884	lipid homeostasis
GO:0080090	0.879	regulation of primary metabolic process
GO:1902652	0.875	secondary alcohol metabolic process
GO:0006629	0.863	lipid metabolic process
GO:0009605	0.862	response to external stimulus
GO:0051716	0.853	cellular response to stimulus
GO:0048522	0.831	positive regulation of cellular process
GO:0097006	0.826	regulation of plasma lipoprotein particle levels
GO:0042632	0.822	cholesterol homeostasis
GO:0031323	0.814	regulation of cellular metabolic process
GO:0071827	0.808	plasma lipoprotein particle organization
GO:0060191	0.804	regulation of lipase activity
GO:0030301	0.802	cholesterol transport
GO:0008203	0.789	cholesterol metabolic process
GO:0046890	0.778	regulation of lipid biosynthetic process
GO:0015914	0.774	phospholipid transport
GO:0006807	0.759	nitrogen compound metabolic process
GO:0045834	0.754	positive regulation of lipid metabolic process
GO:1901564	0.747	organonitrogen compound metabolic process
GO:0048523	0.732	negative regulation of cellular process
GO:0062012	0.702	regulation of small molecule metabolic process
GO:0010565	0.663	regulation of cellular ketone metabolic process
GO:0031326	0.659	regulation of cellular biosynthetic process
GO:0031325	0.653	positive regulation of cellular metabolic process
GO:0002376	0.647	immune system process
GO:0006952	0.643	defense response
GO:0044255	0.641	cellular lipid metabolic process
GO:0044419	0.634	biological process involved in interspecies interaction between organisms
GO:0002385	0.603	mucosal immune response
GO:0070887	0.590	cellular response to chemical stimulus
GO:1901700	0.582	response to oxygen-containing compound
GO:0051707	0.516	response to other organism
GO:0000305	0.513	response to oxygen radical
GO:0022607	0.502	cellular component assembly
GO:0009891	0.485	positive regulation of biosynthetic process
GO:0033554	0.479	cellular response to stress
GO:0031328	0.479	positive regulation of cellular biosynthetic process
GO:0009056	0.467	catabolic process
GO:1901701	0.467	cellular response to oxygen-containing compound
GO:0019217	0.449	regulation of fatty acid metabolic process
GO:0046486	0.437	glycerolipid metabolic process
GO:0009894	0.431	regulation of catabolic process
GO:0050994	0.414	regulation of lipid catabolic process
GO:0042304	0.411	regulation of fatty acid biosynthetic process
GO:0044248	0.410	cellular catabolic process
GO:0050996	0.403	positive regulation of lipid catabolic process
GO:0046889	0.400	positive regulation of lipid biosynthetic process
GO:0060193	0.395	positive regulation of lipase activity
GO:0000303	0.390	response to superoxide
GO:1901575	0.388	organic substance catabolic process
GO:0062013	0.385	positive regulation of small molecule metabolic process
GO:0090207	0.368	regulation of triglyceride metabolic process
GO:0051241	0.353	negative regulation of multicellular organismal process
GO:0098542	0.346	defense response to other organism
GO:0051128	0.345	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005615	1.000	extracellular space
GO:0012505	0.997	endomembrane system
GO:0070013	0.997	intracellular organelle lumen
GO:0043227	0.996	membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0071944	0.977	cell periphery
GO:0034358	0.975	plasma lipoprotein particle
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0034385	0.955	triglyceride-rich plasma lipoprotein particle
GO:0034361	0.954	very-low-density lipoprotein particle
GO:0034364	0.946	high-density lipoprotein particle
GO:0070062	0.913	extracellular exosome
GO:0005783	0.884	endoplasmic reticulum
GO:0016020	0.844	membrane
GO:0031410	0.840	cytoplasmic vesicle
GO:0009986	0.761	cell surface
GO:0030312	0.746	external encapsulating structure
GO:0031012	0.739	extracellular matrix
GO:0005788	0.720	endoplasmic reticulum lumen
GO:0062023	0.715	collagen-containing extracellular matrix
GO:0072562	0.713	blood microparticle
GO:0005768	0.688	endosome
GO:0005769	0.593	early endosome
GO:0042627	0.477	chylomicron
GO:0005886	0.350	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.999	cholesterol(in) = cholesterol(out)

[back to server]