StarFunc result for job id P06731

User Input

>input (702 residues)
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQ
HLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFY
TLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWV
NNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAP
TISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ
AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNN
QSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTI
SPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQAN
NSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQS
LPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISP
PDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNL
ATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0K5	0.848	0.848	0.000	702	0.999	0.999	A0A024R0K5.pdb.gz	A0A024R0K5_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
2	AFDB:A0A087WYX0	0.497	0.659	2.220E-88	524	0.745	0.998	A0A087WYX0.pdb.gz	A0A087WYX0_HUMAN CEA cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
3	PDB:1e07A	0.282	0.302	3.615E-66	642	0.877	0.960	1e07A.pdb.gz
4	AFDB:P13688	0.427	0.561	2.565E-59	526	0.436	0.582	P13688.pdb.gz	CEAM1_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CEACAM1 PE=1 SV=2
5	AFDB:P31809	0.495	0.653	1.494E-51	521	0.298	0.401	P31809.pdb.gz	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
6	AFDB:P16573	0.457	0.597	3.541E-51	519	0.282	0.382	P16573.pdb.gz	CEAM1_RAT Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=4
7	AFDB:Q16557	0.288	0.464	8.805E-51	428	0.335	0.549	Q16557.pdb.gz	PSG3_HUMAN Pregnancy-specific beta-1-glycoprotein 3 OS=Homo sapiens OX=9606 GN=PSG3 PE=2 SV=2
8	AFDB:P40199	0.363	0.680	1.723E-50	344	0.386	0.788	P40199.pdb.gz	CEAM6_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 6 OS=Homo sapiens OX=9606 GN=CEACAM6 PE=1 SV=4
9	AFDB:Q00887	0.284	0.462	1.893E-49	426	0.329	0.542	Q00887.pdb.gz	PSG9_HUMAN Pregnancy-specific beta-1-glycoprotein 9 OS=Homo sapiens OX=9606 GN=PSG9 PE=1 SV=2
10	AFDB:Q00889	0.280	0.444	3.885E-49	435	0.325	0.524	Q00889.pdb.gz	PSG6_HUMAN Pregnancy-specific beta-1-glycoprotein 6 OS=Homo sapiens OX=9606 GN=PSG6 PE=2 SV=1
11	AFDB:Q15228	0.285	0.479	4.276E-49	411	0.323	0.552	Q15228.pdb.gz	Q15228_HUMAN Pregnancy-specific beta-1 glycoprotein (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
12	PDB:5oj2B	0.198	0.201	9.738E-27	692	0.165	0.168	5oj2B.pdb.gz
13	PDB:7sqcO0	0.162	0.116	2.617E-15	1140	0.115	0.071	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:7q5zA	0.131	0.090	3.321E-14	1344	0.104	0.054	7q5zA.pdb.gz
15	PDB:7q1yA	0.126	0.084	3.834E-14	1374	0.111	0.057	7q1yA.pdb.gz
16	PDB:7vonA	0.143	0.094	2.737E-13	1399	0.128	0.064	7vonA.pdb.gz
17	PDB:6dldD	0.190	0.414	4.016E-13	269	0.084	0.219	6dldD.pdb.gz
18	PDB:4aq1A	0.147	0.144	9.518E-13	721	0.128	0.125	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
19	PDB:5a42A	0.119	0.066	1.153E-12	1597	0.131	0.058	5a42A.pdb.gz
20	PDB:7nycA	0.133	0.074	3.007E-12	1542	0.100	0.045	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R0K5	0.0	1428	702	0.999	0.999	A0A024R0K5_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
2	A0A087WYX0	0.0	785	524	0.561	0.752	A0A087WYX0_HUMAN CEA cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
3	P06731	0.0	1428	702	0.999	0.999	CEAM5_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=4
4	P13688	0.0	614	526	0.442	0.589	CEAM1_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CEACAM1 PE=1 SV=2
5	P40199	0.0	558	344	0.386	0.788	CEAM6_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 6 OS=Homo sapiens OX=9606 GN=CEACAM6 PE=1 SV=4
6	P31997	7.69e-169	489	349	0.343	0.691	CEAM8_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 8 OS=Homo sapiens OX=9606 GN=CEACAM8 PE=1 SV=2
7	P16573	8.06e-123	378	519	0.282	0.382	CEAM1_RAT Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=4
8	P31809	8.15e-122	375	521	0.298	0.401	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
9	Q925P2	3.87e-117	363	520	0.281	0.379	CEAM2_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ceacam2 PE=1 SV=3
10	Q15238	5.12e-114	348	335	0.255	0.534	PSG5_HUMAN Pregnancy-specific beta-1-glycoprotein 5 OS=Homo sapiens OX=9606 GN=PSG5 PE=1 SV=3
11	Q9UQ72	2.27e-107	331	335	0.262	0.549	PSG11_HUMAN Pregnancy-specific beta-1-glycoprotein 11 OS=Homo sapiens OX=9606 GN=PSG11 PE=2 SV=3
12	Q14002	2.84e-105	323	265	0.225	0.596	CEAM7_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 7 OS=Homo sapiens OX=9606 GN=CEACAM7 PE=1 SV=2
13	Q00887	9.68e-88	283	426	0.248	0.408	PSG9_HUMAN Pregnancy-specific beta-1-glycoprotein 9 OS=Homo sapiens OX=9606 GN=PSG9 PE=1 SV=2
14	Q13046	2.74e-87	282	419	0.252	0.422	PSG7_HUMAN Pregnancy-specific beta-1-glycoprotein 7 OS=Homo sapiens OX=9606 GN=PSG7 PE=2 SV=3
15	Q00888	5.18e-86	278	419	0.251	0.420	PSG4_HUMAN Pregnancy-specific beta-1-glycoprotein 4 OS=Homo sapiens OX=9606 GN=PSG4 PE=2 SV=3
16	P11464	1.07e-85	278	419	0.245	0.411	PSG1_HUMAN Pregnancy-specific beta-1-glycoprotein 1 OS=Homo sapiens OX=9606 GN=PSG1 PE=1 SV=1
17	Q00889	1.20e-83	273	435	0.265	0.428	PSG6_HUMAN Pregnancy-specific beta-1-glycoprotein 6 OS=Homo sapiens OX=9606 GN=PSG6 PE=2 SV=1
18	Q15228	3.35e-82	268	411	0.241	0.411	Q15228_HUMAN Pregnancy-specific beta-1 glycoprotein (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
19	Q16557	2.20e-80	264	428	0.258	0.423	PSG3_HUMAN Pregnancy-specific beta-1-glycoprotein 3 OS=Homo sapiens OX=9606 GN=PSG3 PE=2 SV=2
20	P40198	1.10e-79	256	252	0.174	0.484	CEAM3_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CEACAM3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	5.2e-06	37.5	Adenovirus E3 region protein CR1
2	PF05790 C2-set	0.0017	29.9	Immunoglobulin C2-set domain
3	PF19280 CERK_C	61	14.5	Ceramide kinase C-terminal domain
4	PF11327 Egh16-like	5.4e+02	12.4	Egh16-like virulence factor
5	PF20418 Herpes_gE_N	1.9e+02	13.3	Alphaherpesvirus glycoprotein E N-terminal
6	PF07679 I-set	1.4e-45	164.6	Immunoglobulin I-set domain
7	PF00047 ig	9.5e-42	152.4	Immunoglobulin domain
8	PF13895 Ig_2	5.9e-59	207.7	Immunoglobulin domain
9	PF13927 Ig_3	2.2e-63	222.1	Immunoglobulin domain
10	PF16680 Ig_4	7e-15	66.7	T-cell surface glycoprotein CD3 delta chain
11	PF16681 Ig_5	1.1e-08	46.7	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
12	PF18452 Ig_6	0.0025	29.1	Immunoglobulin domain
13	PF16706 Izumo-Ig	0.0017	29.6	Izumo-like Immunoglobulin domain
14	PF06328 Lep_receptor_Ig	0.025	25.8	Ig-like C2-type domain
15	PF05808 Podoplanin	85	14.9	Podoplanin
16	PF07686 V-set	8.9e-35	130.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221992

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312002	0.939	Hepatitis A virus cellular receptor 2
2	9606.ENSP00000254301	0.915	Galectin-3
3	9606.ENSP00000379138	0.913	Alpha-fetoprotein
4	9606.ENSP00000484824	0.874	Mucin-1
5	9606.ENSP00000355124	0.862	Keratin, type I cytoskeletal 19
6	9606.ENSP00000437402	0.858	Gamma-enolase
7	9606.ENSP00000329243	0.855	Keratin, type II cytoskeletal 7
8	9606.ENSP00000167588	0.837	Keratin, type I cytoskeletal 20
9	9606.ENSP00000314151	0.830	Prostate-specific antigen
10	9606.ENSP00000469421	0.800	Carcinoembryonic antigen-related cell adhesion molecule 5 isoform 3D
11	9606.ENSP00000315477	0.774	CD209 antigen
12	9606.ENSP00000331746	0.759	Calcitonin
13	9606.ENSP00000269571	0.741	Receptor tyrosine-protein kinase erbB-2
14	9606.ENSP00000255030	0.731	C-reactive protein
15	9606.ENSP00000216492	0.719	Chromogranin-A
16	9606.ENSP00000291009	0.710	Prolactin induced protein
17	9606.ENSP00000295897	0.710	Serum albumin
18	9606.ENSP00000263233	0.705	Synaptophysin
19	9606.ENSP00000263735	0.696	Epithelial cell adhesion molecule
20	9606.ENSP00000256078	0.688	GTPase KRas

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097367	0.998	carbohydrate derivative binding
GO:0046983	0.998	protein dimerization activity
GO:0042802	0.996	identical protein binding
GO:0008289	0.984	lipid binding
GO:0051861	0.971	glycolipid binding
GO:0005543	0.816	phospholipid binding
GO:0035091	0.792	phosphatidylinositol binding
GO:0042803	0.777	protein homodimerization activity
GO:0005102	0.449	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0098742	0.979	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0048519	0.971	negative regulation of biological process
GO:0010941	0.847	regulation of cell death
GO:0048523	0.847	negative regulation of cellular process
GO:0043067	0.816	regulation of programmed cell death
GO:0050896	0.798	response to stimulus
GO:0007157	0.785	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0050793	0.748	regulation of developmental process
GO:0051147	0.738	regulation of muscle cell differentiation
GO:0032501	0.690	multicellular organismal process
GO:0010830	0.684	regulation of myotube differentiation
GO:0034109	0.661	homotypic cell-cell adhesion
GO:0007156	0.578	homophilic cell adhesion via plasma membrane adhesion molecules
GO:0048518	0.498	positive regulation of biological process
GO:0051716	0.495	cellular response to stimulus
GO:0042981	0.435	regulation of apoptotic process
GO:0048522	0.420	positive regulation of cellular process
GO:0048856	0.359	anatomical structure development
GO:0043069	0.356	negative regulation of programmed cell death
GO:0019222	0.330	regulation of metabolic process
GO:0060255	0.321	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.942	extracellular region
GO:0043226	0.768	organelle
GO:0043227	0.752	membrane-bounded organelle
GO:0031982	0.462	vesicle
GO:0005615	0.461	extracellular space
GO:0005622	0.312	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]