StarFunc result for job id P06734

User Input

>input (321 residues)
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06734	1.000	1.000	2.669E-53	321	1.000	1.000	P06734.pdb.gz	FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor OS=Homo sapiens OX=9606 GN=FCER2 PE=1 SV=1
2	AFDB:P20693	0.499	0.485	8.684E-32	331	0.561	0.544	P20693.pdb.gz	FCER2_MOUSE Low affinity immunoglobulin epsilon Fc receptor OS=Mus musculus OX=10090 GN=Fcer2 PE=1 SV=1
3	AFDB:Q8BNX1	0.402	0.437	4.279E-16	294	0.243	0.265	Q8BNX1.pdb.gz	CLC4G_MOUSE C-type lectin domain family 4 member G OS=Mus musculus OX=10090 GN=Clec4g PE=1 SV=1
4	AFDB:P07307	0.374	0.386	4.823E-16	311	0.246	0.254	P07307.pdb.gz	ASGR2_HUMAN Asialoglycoprotein receptor 2 OS=Homo sapiens OX=9606 GN=ASGR2 PE=1 SV=2
5	AFDB:Q6UXB4	0.412	0.450	6.127E-16	293	0.255	0.280	Q6UXB4.pdb.gz	CLC4G_HUMAN C-type lectin domain family 4 member G OS=Homo sapiens OX=9606 GN=CLEC4G PE=1 SV=1
6	AFDB:P49300	0.380	0.403	9.313E-16	304	0.243	0.257	P49300.pdb.gz	CLC10_MOUSE C-type lectin domain family 10 member A OS=Mus musculus OX=10090 GN=Clec10a PE=1 SV=1
7	AFDB:Q6ZS10	0.382	0.327	1.333E-15	378	0.237	0.201	Q6ZS10.pdb.gz	CL17A_HUMAN C-type lectin domain family 17, member A OS=Homo sapiens OX=9606 GN=CLEC17A PE=1 SV=2
8	AFDB:P02706	0.358	0.403	1.596E-15	284	0.243	0.275	P02706.pdb.gz	ASGR1_RAT Asialoglycoprotein receptor 1 OS=Rattus norvegicus OX=10116 GN=Asgr1 PE=1 SV=2
9	AFDB:P34927	0.365	0.411	2.152E-15	284	0.231	0.261	P34927.pdb.gz	ASGR1_MOUSE Asialoglycoprotein receptor 1 OS=Mus musculus OX=10090 GN=Asgr1 PE=1 SV=4
10	AFDB:Q8IUN9	0.359	0.364	3.473E-15	316	0.243	0.247	Q8IUN9.pdb.gz	CLC10_HUMAN C-type lectin domain family 10 member A OS=Homo sapiens OX=9606 GN=CLEC10A PE=1 SV=1
11	PDB:1qddA	0.364	0.787	1.180E-11	144	0.128	0.285	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
12	PDB:7wz8A	0.359	0.625	1.794E-11	180	0.171	0.306	7wz8A.pdb.gz
13	PDB:5f2qB	0.346	0.777	8.498E-11	135	0.128	0.304	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
14	PDB:4mthA	0.350	0.772	6.496E-10	139	0.112	0.259	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
15	PDB:1htnA	0.349	0.692	8.253E-10	156	0.118	0.244	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
16	PDB:1gz2A	0.344	0.757	1.018E-8	139	0.090	0.209	1gz2A.pdb.gz
17	PDB:3bx4C	0.297	0.685	1.018E-8	134	0.115	0.276	3bx4C.pdb.gz
18	PDB:7qsrA	0.347	0.089	1.373E-8	1335	0.137	0.033	7qsrA.pdb.gz
19	PDB:1bj3A	0.276	0.650	1.744E-8	129	0.121	0.302	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
20	PDB:7jptA	0.339	0.085	2.815E-8	1327	0.115	0.028	7jptA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06734	0.0	664	321	1.000	1.000	FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor OS=Homo sapiens OX=9606 GN=FCER2 PE=1 SV=1
2	P20693	8.91e-123	357	331	0.558	0.541	FCER2_MOUSE Low affinity immunoglobulin epsilon Fc receptor OS=Mus musculus OX=10090 GN=Fcer2 PE=1 SV=1
3	Q6UXB4	2.29e-29	115	293	0.252	0.276	CLC4G_HUMAN C-type lectin domain family 4 member G OS=Homo sapiens OX=9606 GN=CLEC4G PE=1 SV=1
4	Q8BNX1	3.58e-28	112	294	0.199	0.218	CLC4G_MOUSE C-type lectin domain family 4 member G OS=Mus musculus OX=10090 GN=Clec4g PE=1 SV=1
5	Q8CJ91	1.34e-26	108	325	0.274	0.271	C209B_MOUSE CD209 antigen-like protein B OS=Mus musculus OX=10090 GN=Cd209b PE=1 SV=2
6	Q6ZS10	2.31e-25	106	378	0.212	0.180	CL17A_HUMAN C-type lectin domain family 17, member A OS=Homo sapiens OX=9606 GN=CLEC17A PE=1 SV=2
7	Q9H2X3	2.78e-25	106	399	0.227	0.183	CLC4M_HUMAN C-type lectin domain family 4 member M OS=Homo sapiens OX=9606 GN=CLEC4M PE=1 SV=1
8	Q91ZW9	8.51e-25	100	178	0.187	0.337	C209C_MOUSE CD209 antigen-like protein C OS=Mus musculus OX=10090 GN=Cd209c PE=2 SV=1
9	Q91ZW7	3.89e-24	99.8	208	0.171	0.264	C209E_MOUSE CD209 antigen-like protein E OS=Mus musculus OX=10090 GN=Cd209e PE=2 SV=1
10	Q8K4Q8	3.67e-23	102	742	0.162	0.070	COL12_MOUSE Collectin-12 OS=Mus musculus OX=10090 GN=Colec12 PE=1 SV=1
11	Q91ZX1	6.29e-23	97.1	238	0.187	0.252	C209A_MOUSE CD209 antigen-like protein A OS=Mus musculus OX=10090 GN=Cd209a PE=2 SV=1
12	P07307	2.77e-22	97.1	311	0.231	0.238	ASGR2_HUMAN Asialoglycoprotein receptor 2 OS=Homo sapiens OX=9606 GN=ASGR2 PE=1 SV=2
13	Q9NNX6	4.22e-22	97.8	404	0.234	0.186	CD209_HUMAN CD209 antigen OS=Homo sapiens OX=9606 GN=CD209 PE=1 SV=1
14	P24721	4.48e-22	96.3	301	0.231	0.246	ASGR2_MOUSE Asialoglycoprotein receptor 2 OS=Mus musculus OX=10090 GN=Asgr2 PE=1 SV=1
15	Q8JZN1	2.08e-21	94.7	332	0.209	0.202	Q8JZN1_MOUSE Macrophage galactose N-acetyl-galactosamine specific lectin 2 OS=Mus musculus OX=10090 GN=Mgl2 PE=1 SV=1
16	P49300	3.97e-21	93.6	304	0.206	0.217	CLC10_MOUSE C-type lectin domain family 10 member A OS=Mus musculus OX=10090 GN=Clec10a PE=1 SV=1
17	P07306	4.01e-21	93.6	291	0.209	0.230	ASGR1_HUMAN Asialoglycoprotein receptor 1 OS=Homo sapiens OX=9606 GN=ASGR1 PE=1 SV=2
18	Q91ZW8	5.06e-21	92.0	237	0.165	0.224	C209D_MOUSE CD209 antigen-like protein D OS=Mus musculus OX=10090 GN=Cd209d PE=2 SV=1
19	Q8IUN9	3.56e-20	91.3	316	0.215	0.218	CLC10_HUMAN C-type lectin domain family 10 member A OS=Homo sapiens OX=9606 GN=CLEC10A PE=1 SV=1
20	P34927	8.02e-20	89.7	284	0.168	0.190	ASGR1_MOUSE Asialoglycoprotein receptor 1 OS=Mus musculus OX=10090 GN=Asgr1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03915 AIP3	22	15.6	Actin interacting protein 3
2	PF15960 DUF4763	97	13.7	Domain of unknown function (DUF4763)
3	PF20570 DUF6779	15	17.7	Domain of unknown function (DUF6779)
4	PF09787 Golgin_A5	3.9e+02	11.9	Golgin subfamily A member 5
5	PF14932 HAUS-augmin3	8.5e+02	10.8	HAUS augmin-like complex subunit 3
6	PF00059 Lectin_C	7.1e-22	89.5	Lectin C-type domain
7	PF12389 Peptidase_M73	8.2e+02	11.2	Camelysin metallo-endopeptidase
8	PF05473 UL45	1.6e+02	13.3	UL45 protein, carbohydrate-binding C-type lectin-like
9	PF06785 UPF0242	16	17.0	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264072

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356024	0.979	Complement receptor type 2
2	9606.ENSP00000300134	0.949	Signal transducer and activator of transcription 6
3	9606.ENSP00000332049	0.948	T-lymphocyte activation antigen CD86
4	9606.ENSP00000380948	0.947	Integrin beta-2
5	9606.ENSP00000454623	0.945	Integrin alpha-X
6	9606.ENSP00000304915	0.944	Interleukin-13
7	9606.ENSP00000264832	0.938	Intercellular adhesion molecule 1
8	9606.ENSP00000379111	0.938	Interleukin-4 receptor subunit alpha
9	9606.ENSP00000256646	0.937	Neurogenic locus notch homolog protein 2
10	9606.ENSP00000441691	0.936	Integrin alpha-M
11	9606.ENSP00000264246	0.934	T-lymphocyte activation antigen CD80
12	9606.ENSP00000412237	0.929	Interleukin-10
13	9606.ENSP00000330959	0.916	Interleukin-1 receptor type 2
14	9606.ENSP00000345206	0.913	Recombining binding protein suppressor of hairless
15	9606.ENSP00000294728	0.911	Vascular cell adhesion protein 1
16	9606.ENSP00000386380	0.908	Interleukin-1 receptor type 1
17	9606.ENSP00000379350	0.905	Integrin beta-1
18	9606.ENSP00000327513	0.904	Macrophage colony-stimulating factor 1
19	9606.ENSP00000234961	0.900	Delta-type opioid receptor
20	9606.ENSP00000292599	0.900	Mastermind-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	0.995	integrin binding
GO:0043167	0.990	ion binding
GO:0046872	0.975	metal ion binding
GO:0042802	0.556	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0048518	0.951	positive regulation of biological process
GO:0048522	0.924	positive regulation of cellular process
GO:0060255	0.863	regulation of macromolecule metabolic process
GO:0009987	0.833	cellular process
GO:0050896	0.785	response to stimulus
GO:0031341	0.773	regulation of cell killing
GO:0009893	0.741	positive regulation of metabolic process
GO:0050790	0.718	regulation of catalytic activity
GO:0051341	0.605	regulation of oxidoreductase activity
GO:0010604	0.604	positive regulation of macromolecule metabolic process
GO:0044419	0.440	biological process involved in interspecies interaction between organisms
GO:0002684	0.395	positive regulation of immune system process
GO:0031323	0.381	regulation of cellular metabolic process
GO:0051716	0.365	cellular response to stimulus
GO:0010941	0.363	regulation of cell death
GO:0051171	0.354	regulation of nitrogen compound metabolic process
GO:0010468	0.352	regulation of gene expression
GO:0048583	0.350	regulation of response to stimulus
GO:0002376	0.334	immune system process
GO:0032501	0.332	multicellular organismal process
GO:0048584	0.326	positive regulation of response to stimulus
GO:0031325	0.316	positive regulation of cellular metabolic process
GO:0032502	0.310	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.994	membrane-bounded organelle
GO:0005576	0.984	extracellular region
GO:0031982	0.923	vesicle
GO:0005615	0.849	extracellular space
GO:0043230	0.842	extracellular organelle
GO:0065010	0.830	extracellular membrane-bounded organelle
GO:1903561	0.816	extracellular vesicle
GO:0070062	0.777	extracellular exosome
GO:0005622	0.733	intracellular anatomical structure
GO:0043231	0.670	intracellular membrane-bounded organelle
GO:0005737	0.541	cytoplasm
GO:0009986	0.446	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]