StarFunc result for job id P06737

User Input

>input (847 residues)
MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDI
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEA
DDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQ
ENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFV
PRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE
SNKVNGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1e1yA	0.945	0.984	0.000	813	0.776	0.808	1e1yA.pdb.gz	Flavopiridol Inhibits Glycogen Phosphorylase by Binding at the Inhibitor Site
2	PDB:1fa9A	0.974	0.989	0.000	834	0.985	1.000	1fa9A.pdb.gz	Activation of human liver glycogen phosphorylase by alteration of the secondary structure and packing of the catalytic core.
3	PDB:2qllA	0.939	0.986	0.000	806	0.950	0.999	2qllA.pdb.gz	Molecular recognition of the protein phosphatase 1 glycogen targeting subunit by glycogen phosphorylase.
4	PDB:3gpbA	0.949	0.965	0.000	833	0.787	0.801	3gpbA.pdb.gz	Comparison of the binding of glucose and glucose 1-phosphate derivatives to T-state glycogen phosphorylase b.
5	PDB:5ikoA	0.937	0.983	0.000	807	0.787	0.827	5ikoA.pdb.gz	Insights into Brain Glycogen Metabolism: THE STRUCTURE OF HUMAN BRAIN GLYCOGEN PHOSPHORYLASE.
6	AFDB:E1BSN7	0.955	0.959	0.000	843	0.800	0.804	E1BSN7.pdb.gz	E1BSN7_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=PYGB PE=1 SV=2
7	AFDB:E7EXT3	0.983	0.989	0.000	842	0.790	0.795	E7EXT3.pdb.gz	E7EXT3_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=zgc:63642 PE=1 SV=1
8	AFDB:P00489	0.982	0.986	0.000	843	0.797	0.801	P00489.pdb.gz	PYGM_RABIT Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3
9	AFDB:P09811	0.969	0.966	0.000	850	0.947	0.944	P09811.pdb.gz	PYGL_RAT Glycogen phosphorylase, liver form OS=Rattus norvegicus OX=10116 GN=Pygl PE=1 SV=5
10	AFDB:Q503C7	0.979	0.985	0.000	842	0.777	0.781	Q503C7.pdb.gz	Q503C7_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=im:7150327 PE=1 SV=1
11	AFDB:Q9XTL9	0.984	0.988	0.000	844	0.715	0.718	Q9XTL9.pdb.gz	PYG_DROME Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=Glyp PE=2 SV=2
12	AFDB:P0AC86	0.944	0.980	2.438E-92	815	0.481	0.499	P0AC86.pdb.gz	PHSG_ECOLI Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
13	AFDB:Q00766	0.936	0.930	1.081E-87	853	0.463	0.460	Q00766.pdb.gz	PHS1_DICDI Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
14	AFDB:P34114	0.936	0.800	1.131E-85	993	0.460	0.393	P34114.pdb.gz	PHS2_DICDI Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
15	AFDB:Q6FUB0	0.934	0.881	4.585E-83	899	0.483	0.455	Q6FUB0.pdb.gz	Q6FUB0_CANGA Alpha-1,4 glucan phosphorylase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F04895g PE=3 SV=1
16	PDB:1ygpA	0.921	0.909	1.130E-78	858	0.486	0.480	1ygpA.pdb.gz	A protein phosphorylation switch at the conserved allosteric site in GP.
17	PDB:4bqfB	0.917	0.939	1.130E-76	827	0.439	0.450	4bqfB.pdb.gz	Sugar-Coated Sensor Chip and Nanoparticle Surfaces for the in Vitro Enzymatic Synthesis of Starch-Like Materials
18	PDB:1ahpA	0.904	0.961	3.052E-73	796	0.405	0.431	1ahpA.pdb.gz	Oligosaccharide substrate binding in Escherichia coli maltodextrin phosphorylase.
19	PDB:3guhA	0.417	0.695	1.619E-10	477	0.091	0.161	3guhA.pdb.gz	The Crystal Structures of the Open and Catalytically Competent Closed Conformation of Escherichia coli Glycogen Synthase.
20	PDB:4qlbD	0.309	0.385	2.123E-6	651	0.116	0.151	4qlbD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PQQ3	753	900	0.482	0.453	A0A1D8PQQ3_CANAL Alpha-1,4 glucan phosphorylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPH1 PE=3 SV=1
2	E1BSN7	1411	843	0.800	0.804	E1BSN7_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=PYGB PE=1 SV=2
3	E7EXT3	1404	842	0.790	0.795	E7EXT3_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=zgc:63642 PE=1 SV=1
4	P00489	1417	843	0.798	0.802	PYGM_RABIT Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3
5	P00490	692	797	0.414	0.440	PHSM_ECOLI Maltodextrin phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=malP PE=1 SV=7
6	P06737	1762	847	1.000	1.000	PYGL_HUMAN Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4
7	P06738	749	902	0.492	0.462	PHSG_YEAST Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
8	P09811	1645	850	0.948	0.945	PYGL_RAT Glycogen phosphorylase, liver form OS=Rattus norvegicus OX=10116 GN=Pygl PE=1 SV=5
9	P09812	1395	842	0.784	0.789	PYGM_RAT Glycogen phosphorylase, muscle form OS=Rattus norvegicus OX=10116 GN=Pygm PE=1 SV=5
10	P0AC86	814	815	0.479	0.498	PHSG_ECOLI Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
11	P11216	1422	843	0.811	0.815	PYGB_HUMAN Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5
12	P11217	1416	842	0.795	0.799	PYGM_HUMAN Glycogen phosphorylase, muscle form OS=Homo sapiens OX=9606 GN=PYGM PE=1 SV=6
13	P34114	741	993	0.463	0.395	PHS2_DICDI Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
14	P53534	1397	838	0.804	0.813	PYGB_RAT Glycogen phosphorylase, brain form (Fragment) OS=Rattus norvegicus OX=10116 GN=Pygb PE=1 SV=3
15	Q00766	794	853	0.471	0.468	PHS1_DICDI Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
16	Q503C7	1399	842	0.776	0.780	Q503C7_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=im:7150327 PE=1 SV=1
17	Q5ZME4	1407	843	0.798	0.802	Q5ZME4_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=RCJMB04_2f16 PE=2 SV=1
18	Q6FUB0	743	899	0.489	0.461	Q6FUB0_CANGA Alpha-1,4 glucan phosphorylase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F04895g PE=3 SV=1
19	Q8CI94	1394	843	0.803	0.807	PYGB_MOUSE Glycogen phosphorylase, brain form OS=Mus musculus OX=10090 GN=Pygb PE=1 SV=3
20	Q9ET01	1644	850	0.949	0.946	PYGL_MOUSE Glycogen phosphorylase, liver form OS=Mus musculus OX=10090 GN=Pygl PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00343 Phosphorylase	0	1127.5	Carbohydrate phosphorylase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216392

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410833	0.994	1,4-alpha-glucan-branching enzyme
2	9606.ENSP00000294724	0.992	Glycogen debranching enzyme
3	9606.ENSP00000360124	0.981	Phosphoglucomutase-1
4	9606.ENSP00000338703	0.973	UTP--glucose-1-phosphate uridylyltransferase
5	9606.ENSP00000216962	0.971	Glycogen phosphorylase, brain form
6	9606.ENSP00000455607	0.963	Phosphorylase b kinase gamma catalytic chain, liver/testis isoform
7	9606.ENSP00000313504	0.959	Phosphorylase b kinase regulatory subunit beta
8	9606.ENSP00000369274	0.949	Phosphorylase b kinase regulatory subunit alpha, liver isoform
9	9606.ENSP00000370555	0.936	Glycogenin-2
10	9606.ENSP00000298198	0.933	Glucose 1,6-bisphosphate synthase
11	9606.ENSP00000447378	0.933	Maltase-glucoamylase, intestinal
12	9606.ENSP00000164139	0.931	Glycogen phosphorylase, muscle form
13	9606.ENSP00000371393	0.925	Phosphoglucomutase-2
14	9606.ENSP00000261195	0.923	Glycogen [starch] synthase, liver
15	9606.ENSP00000447431	0.923	Probable maltase-glucoamylase 2
16	9606.ENSP00000354238	0.916	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
17	9606.ENSP00000406261	0.909	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
18	9606.ENSP00000216274	0.901	Receptor-interacting serine/threonine-protein kinase 3
19	9606.ENSP00000317904	0.899	Glycogen [starch] synthase, muscle
20	9606.ENSP00000269848	0.829	ATP-dependent 6-phosphofructokinase, liver type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008184	0.999	glycogen phosphorylase activity
GO:0042802	0.832	identical protein binding
GO:0097159	0.827	organic cyclic compound binding
GO:1901363	0.817	heterocyclic compound binding
GO:0043167	0.772	ion binding
GO:0043168	0.725	anion binding
GO:0036094	0.709	small molecule binding
GO:0030246	0.427	carbohydrate binding
GO:0019842	0.418	vitamin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044042	0.992	glucan metabolic process
GO:0006073	0.975	cellular glucan metabolic process
GO:0005977	0.973	glycogen metabolic process
GO:0016052	0.965	carbohydrate catabolic process
GO:0009251	0.945	glucan catabolic process
GO:0044247	0.945	cellular polysaccharide catabolic process
GO:0005980	0.921	glycogen catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005829	0.950	cytosol
GO:0043227	0.917	membrane-bounded organelle
GO:0043229	0.915	intracellular organelle
GO:0043231	0.888	intracellular membrane-bounded organelle
GO:0031982	0.443	vesicle
GO:0012505	0.424	endomembrane system
GO:0070013	0.401	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.1	0.999	glycogen phosphorylase.

[back to server]