StarFunc result for job id P06748

User Input

>input (294 residues)
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD
FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z491	0.550	0.550	4.144E-44	294	1.000	1.000	A0A0S2Z491.pdb.gz	A0A0S2Z491_HUMAN Nucleophosmin (Fragment) OS=Homo sapiens OX=9606 GN=NPM1 PE=2 SV=1
2	AFDB:P07222	0.564	0.556	7.028E-32	299	0.660	0.649	P07222.pdb.gz	NPM_XENLA Nucleophosmin OS=Xenopus laevis OX=8355 GN=npm1 PE=1 SV=1
3	AFDB:Q7T362	0.368	0.384	3.712E-27	282	0.486	0.507	Q7T362.pdb.gz
4	AFDB:F1RD77	0.376	0.338	2.875E-25	329	0.459	0.410	F1RD77.pdb.gz
5	AFDB:Q80W85	0.348	0.485	2.992E-15	207	0.214	0.304	Q80W85.pdb.gz	NPM2_MOUSE Nucleoplasmin-2 OS=Mus musculus OX=10090 GN=Npm2 PE=2 SV=1
6	AFDB:O75607	0.361	0.581	4.217E-15	178	0.201	0.331	O75607.pdb.gz	NPM3_HUMAN Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3
7	AFDB:Q7M6Z1	0.363	0.494	5.615E-15	207	0.235	0.333	Q7M6Z1.pdb.gz
8	AFDB:Q9CPP0	0.369	0.607	9.398E-15	175	0.177	0.297	Q9CPP0.pdb.gz	NPM3_MOUSE Nucleoplasmin-3 OS=Mus musculus OX=10090 GN=Npm3 PE=1 SV=3
9	AFDB:Q86SE8	0.340	0.455	3.879E-13	214	0.214	0.294	Q86SE8.pdb.gz	NPM2_HUMAN Nucleoplasmin-2 OS=Homo sapiens OX=9606 GN=NPM2 PE=1 SV=1
10	AFDB:Q27415	0.320	0.588	4.687E-10	152	0.133	0.257	Q27415.pdb.gz	NLP_DROME Nucleoplasmin-like protein OS=Drosophila melanogaster OX=7227 GN=Nlp PE=1 SV=1
11	PDB:1js9C	0.217	0.299	4.622E-3	189	0.051	0.079	1js9C.pdb.gz
12	PDB:3iwzD	0.148	0.194	1.933E-2	208	0.031	0.043	3iwzD.pdb.gz
13	PDB:2waaA	0.182	0.166	2.047E-2	335	0.051	0.045	2waaA.pdb.gz
14	PDB:4yarA	0.187	0.136	2.047E-2	429	0.051	0.035	4yarA.pdb.gz
15	PDB:4orfA	0.136	0.128	2.295E-2	319	0.044	0.041	4orfA.pdb.gz
16	PDB:6ds5A	0.170	0.252	2.295E-2	160	0.048	0.087	6ds5A.pdb.gz
17	PDB:3i26D	0.207	0.172	2.430E-2	369	0.041	0.033	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
18	PDB:6b9tD	0.176	0.123	2.573E-2	453	0.061	0.040	6b9tD.pdb.gz	Structural basis for methylphosphonate biosynthesis.
19	PDB:4avaA	0.164	0.150	2.725E-2	327	0.027	0.024	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.
20	PDB:4lejA	0.163	0.139	2.885E-2	355	0.034	0.028	4lejA.pdb.gz	Crystal Structure of Korean Pine ( Pinus koraiensis ) 7S Seed Storage Protein with Copper Ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z491	0.0	598	294	1.000	1.000	A0A0S2Z491_HUMAN Nucleophosmin (Fragment) OS=Homo sapiens OX=9606 GN=NPM1 PE=2 SV=1
2	A0A140VJQ2	0.0	516	259	0.874	0.992	A0A140VJQ2_HUMAN Testicular tissue protein Li 128 OS=Homo sapiens OX=9606 PE=2 SV=1
3	P06748	0.0	598	294	1.000	1.000	NPM_HUMAN Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2
4	P13084	5.45e-176	489	292	0.932	0.938	NPM_RAT Nucleophosmin OS=Rattus norvegicus OX=10116 GN=Npm1 PE=1 SV=1
5	Q61937	5.45e-176	489	292	0.932	0.938	NPM_MOUSE Nucleophosmin OS=Mus musculus OX=10090 GN=Npm1 PE=1 SV=1
6	E5RI98	1.64e-166	462	230	0.782	1.000	E5RI98_HUMAN Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2
7	Q5BL09	1.01e-143	406	257	0.803	0.918	Q5BL09_MOUSE Npm1 protein OS=Mus musculus OX=10090 GN=Npm1 PE=2 SV=1
8	P07222	1.40e-111	326	299	0.653	0.642	NPM_XENLA Nucleophosmin OS=Xenopus laevis OX=8355 GN=npm1 PE=1 SV=1
9	E7FCU0	7.40e-68	214	279	0.449	0.473	E7FCU0_DANRE Nucleophosmin OS=Danio rerio OX=7955 GN=npm1 PE=1 SV=1
10	Q566X7	1.80e-59	194	307	0.483	0.463	Q566X7_DANRE Nucleophosmin (Fragment) OS=Danio rerio OX=7955 GN=npm4 PE=2 SV=1
11	Q6GQG6	5.70e-30	114	200	0.207	0.305	Q6GQG6_XENLA Npm-A protein OS=Xenopus laevis OX=8355 GN=npm2.L PE=1 SV=1
12	P05221	1.65e-29	113	200	0.207	0.305	NUPL_XENLA Nucleoplasmin OS=Xenopus laevis OX=8355 PE=1 SV=1
13	O75607	1.59e-23	96.7	178	0.167	0.275	NPM3_HUMAN Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3
14	Q9CPP0	2.74e-22	93.2	175	0.160	0.269	NPM3_MOUSE Nucleoplasmin-3 OS=Mus musculus OX=10090 GN=Npm3 PE=1 SV=3
15	B2CQD3	3.68e-22	93.2	182	0.156	0.253	B2CQD3_DANRE Nucleophosmin/nucleoplasmin, 2b OS=Danio rerio OX=7955 GN=npm2 PE=1 SV=2
16	A0A8I5YBJ6	7.23e-16	76.6	210	0.150	0.210	A0A8I5YBJ6_RAT Nucleophosmin/nucleoplasmin 2 OS=Rattus norvegicus OX=10116 GN=Npm2 PE=3 SV=1
17	Q80W85	1.56e-15	75.9	207	0.143	0.203	NPM2_MOUSE Nucleoplasmin-2 OS=Mus musculus OX=10090 GN=Npm2 PE=2 SV=1
18	Q86SE8	3.02e-14	72.4	214	0.139	0.192	NPM2_HUMAN Nucleoplasmin-2 OS=Homo sapiens OX=9606 GN=NPM2 PE=1 SV=1
19	Q9NLA3	4.69e-10	62.0	346	0.116	0.098	ANO39_PATPE Nucleoplasmin-like protein ANO39 OS=Patiria pectinifera OX=7594 PE=1 SV=1
20	Q9VAC4	0.001	40.8	156	0.099	0.186	Q9VAC4_DROME GEO09167p1 OS=Drosophila melanogaster OX=7227 GN=Nph PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02724 CDC45	8.2e+02	9.6	CDC45-like protein
2	PF06524 NOA36	1.6e+02	13.0	NOA36 protein
3	PF04147 Nop14	62	13.3	Nop14-like family
4	PF16276 NPM1-C	3.2e-28	108.8	Nucleophosmin C-terminal domain
5	PF03066 Nucleoplasmin	3.6e-37	138.3	Nucleoplasmin/nucleophosmin domain
6	PF05285 SDA1	6.3	17.8	SDA1
7	PF05793 TFIIF_alpha	3.9e+02	11.0	Transcription initiation factor IIF, alpha subunit (TFIIF-alpha)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296930

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
2	9606.ENSP00000318195	0.999	Nucleolin
3	9606.ENSP00000418915	0.998	Cyclin-dependent kinase inhibitor 2A
4	9606.ENSP00000264010	0.996	Transcriptional repressor CTCF
5	9606.ENSP00000258149	0.995	E3 ubiquitin-protein ligase Mdm2
6	9606.ENSP00000216714	0.992	DNA-(apurinic or apyrimidinic site) lyase
7	9606.ENSP00000373700	0.991	ALK tyrosine kinase receptor
8	9606.ENSP00000264670	0.990	tRNA (cytosine(34)-C(5))-methyltransferase
9	9606.ENSP00000336868	0.989	Histone H3-like centromeric protein A
10	9606.ENSP00000313950	0.972	Aurora kinase B
11	9606.ENSP00000369497	0.972	Breast cancer type 2 susceptibility protein
12	9606.ENSP00000384863	0.970	Exportin-1
13	9606.ENSP00000359345	0.969	60S ribosomal protein L5
14	9606.ENSP00000414109	0.969	Holliday junction recognition protein
15	9606.ENSP00000220592	0.967	Protein argonaute-2
16	9606.ENSP00000373620	0.964	60 kDa heat shock protein, mitochondrial
17	9606.ENSP00000317985	0.959	Rho-associated protein kinase 2
18	9606.ENSP00000371858	0.954	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
19	9606.ENSP00000479618	0.952	Myc proto-oncogene protein
20	9606.ENSP00000405965	0.949	Small ubiquitin-related modifier 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003676	0.966	nucleic acid binding
GO:0003723	0.941	RNA binding
GO:0019899	0.859	enzyme binding
GO:0003677	0.350	DNA binding
GO:0019843	0.346	rRNA binding
GO:0008134	0.340	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0010941	0.986	regulation of cell death
GO:0019222	0.895	regulation of metabolic process
GO:0042981	0.894	regulation of apoptotic process
GO:0051171	0.889	regulation of nitrogen compound metabolic process
GO:0080090	0.883	regulation of primary metabolic process
GO:0048519	0.876	negative regulation of biological process
GO:0060255	0.851	regulation of macromolecule metabolic process
GO:0031323	0.851	regulation of cellular metabolic process
GO:0048518	0.829	positive regulation of biological process
GO:0048522	0.739	positive regulation of cellular process
GO:0071840	0.726	cellular component organization or biogenesis
GO:0019219	0.722	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.669	positive regulation of macromolecule metabolic process
GO:0008152	0.650	metabolic process
GO:0051173	0.630	positive regulation of nitrogen compound metabolic process
GO:0071704	0.621	organic substance metabolic process
GO:0048523	0.609	negative regulation of cellular process
GO:0031325	0.607	positive regulation of cellular metabolic process
GO:0044085	0.573	cellular component biogenesis
GO:0043170	0.569	macromolecule metabolic process
GO:0044238	0.513	primary metabolic process
GO:0006807	0.508	nitrogen compound metabolic process
GO:0044237	0.457	cellular metabolic process
GO:0031326	0.450	regulation of cellular biosynthetic process
GO:0010556	0.449	regulation of macromolecule biosynthetic process
GO:0065009	0.433	regulation of molecular function
GO:0050790	0.422	regulation of catalytic activity
GO:0045935	0.392	positive regulation of nucleobase-containing compound metabolic process
GO:0034641	0.325	cellular nitrogen compound metabolic process
GO:0043069	0.321	negative regulation of programmed cell death
GO:0010468	0.317	regulation of gene expression
GO:0050896	0.306	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0032991	0.902	protein-containing complex
GO:0005737	0.895	cytoplasm
GO:0005829	0.814	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]