StarFunc result for job id P06756

User Input

>input (1048 residues)
MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4g1eA	0.862	0.935	0.000	964	0.894	0.972	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
2	PDB:7nxdA	0.565	0.651	0.000	905	0.416	0.482	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
3	AFDB:A0A023GU64	0.823	0.815	0.000	1059	0.459	0.454	A0A023GU64.pdb.gz
4	AFDB:A0A0G2JVZ6	0.917	0.913	0.000	1052	0.883	0.879	A0A0G2JVZ6.pdb.gz	A0A0G2JVZ6_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=2
5	AFDB:A0A0G2K1E2	0.846	0.808	0.000	1099	0.458	0.437	A0A0G2K1E2.pdb.gz	A0A0G2K1E2_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=3 SV=2
6	AFDB:A2ARA8	0.884	0.873	0.000	1062	0.472	0.466	A2ARA8.pdb.gz	ITA8_MOUSE Integrin alpha-8 OS=Mus musculus OX=10090 GN=Itga8 PE=1 SV=1
7	AFDB:B3DIZ6	0.728	0.736	0.000	1037	0.392	0.396	B3DIZ6.pdb.gz
8	AFDB:B3DJQ3	0.855	0.858	0.000	1045	0.589	0.590	B3DJQ3.pdb.gz
9	AFDB:D3ZAC0	0.785	0.795	0.000	1034	0.371	0.376	D3ZAC0.pdb.gz	D3ZAC0_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=3
10	AFDB:G3HHR9	0.827	0.916	0.000	944	0.841	0.933	G3HHR9.pdb.gz	G3HHR9_CRIGR Integrin alpha-V OS=Cricetulus griseus OX=10029 GN=I79_010178 PE=3 SV=1
11	AFDB:L7RXH0	0.926	0.926	0.000	1048	1.000	1.000	L7RXH0.pdb.gz	L7RXH0_HUMAN Integrin, alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=3 SV=1
12	AFDB:P08514	0.807	0.814	0.000	1039	0.375	0.378	P08514.pdb.gz	ITA2B_HUMAN Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=3
13	PDB:3fcsA	0.775	0.883	9.283E-100	913	0.342	0.392	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
14	PDB:7uslA	0.569	0.676	6.502E-61	856	0.198	0.243	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
15	PDB:4nehA	0.555	0.539	8.501E-59	1084	0.213	0.206	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
16	PDB:4nenA	0.511	0.504	9.720E-58	1063	0.204	0.201	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
17	PDB:3k6sC	0.558	0.653	6.786E-55	885	0.205	0.243	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
18	PDB:5a42A	0.130	0.100	4.050E-10	1597	0.092	0.060	5a42A.pdb.gz
19	PDB:7sqcO0	0.110	0.104	5.392E-9	1140	0.048	0.044	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:4rtdA	0.106	0.102	1.155E-8	1122	0.073	0.068	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVZ6	1755	1007	0.844	0.879	A0A0G2JVZ6_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=2
2	A0A0G2K1E2	815	1098	0.427	0.407	A0A0G2K1E2_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=3 SV=2
3	A0A8I5Y696	874	1009	0.444	0.461	A0A8I5Y696_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
4	A0A8I5YCC9	902	1050	0.449	0.449	A0A8I5YCC9_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=1 SV=1
5	A0A8I6A7G7	887	1044	0.442	0.443	A0A8I6A7G7_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=1 SV=1
6	A0A8I6GGN2	589	1037	0.379	0.383	A0A8I6GGN2_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=1
7	A0A8I6GID8	927	1063	0.462	0.455	A0A8I6GID8_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
8	A2ARA8	961	1062	0.473	0.467	ITA8_MOUSE Integrin alpha-8 OS=Mus musculus OX=10090 GN=Itga8 PE=1 SV=1
9	A2RQD8	1955	1046	0.930	0.932	A2RQD8_PIG Alpha v integrin subunit variant OS=Sus scrofa OX=9823 GN=ITGAV PE=2 SV=1
10	B5DEG1	960	1062	0.467	0.460	B5DEG1_RAT RGD1564327 protein OS=Rattus norvegicus OX=10116 GN=Itga8 PE=2 SV=1
11	D3ZAC0	556	1020	0.356	0.366	D3ZAC0_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=3
12	F1LZX9	1921	1042	0.906	0.911	F1LZX9_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=4
13	F7F1E3	944	1086	0.467	0.450	F7F1E3_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
14	G3HHR9	1773	944	0.843	0.935	G3HHR9_CRIGR Integrin alpha-V OS=Cricetulus griseus OX=10029 GN=I79_010178 PE=3 SV=1
15	L7RXH0	2174	1048	1.000	1.000	L7RXH0_HUMAN Integrin, alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=3 SV=1
16	P06756	2174	1048	1.000	1.000	ITAV_HUMAN Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=2
17	P08514	613	1039	0.380	0.383	ITA2B_HUMAN Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=3
18	P08648	893	1049	0.450	0.450	ITA5_HUMAN Integrin alpha-5 OS=Homo sapiens OX=9606 GN=ITGA5 PE=1 SV=2
19	P11688	908	1053	0.451	0.449	ITA5_MOUSE Integrin alpha-5 OS=Mus musculus OX=10090 GN=Itga5 PE=1 SV=3
20	P26008	1725	1034	0.812	0.823	ITAV_CHICK Integrin alpha-V OS=Gallus gallus OX=9031 GN=ITGAV PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	1.5e-24	96.7	FG-GAP repeat
2	PF13517 FG-GAP_3	1.6e-10	52.7	FG-GAP-like repeat
3	PF00357 Integrin_alpha	0.21	22.7	Integrin alpha cytoplasmic region
4	PF08441 Integrin_alpha2	5.4e-117	403.3	Integrin alpha
5	PF15686 LYRIC	8.1	17.4	Lysine-rich CEACAM1 co-isolated protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261023

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222573	0.999	Integrin beta-8
2	9606.ENSP00000226218	0.999	Vitronectin
3	9606.ENSP00000283249	0.999	Integrin beta-6
4	9606.ENSP00000296181	0.999	Integrin beta-5
5	9606.ENSP00000346839	0.999	Fibronectin type III domain containing
6	9606.ENSP00000378517	0.999	Osteopontin
7	9606.ENSP00000379350	0.999	Integrin beta-1
8	9606.ENSP00000452786	0.999	Integrin beta-3
9	9606.ENSP00000268150	0.997	Lactadherin
10	9606.ENSP00000221930	0.991	Transforming growth factor beta-1
11	9606.ENSP00000341189	0.989	Focal adhesion kinase 1
12	9606.ENSP00000380948	0.974	Integrin beta-2
13	9606.ENSP00000379975	0.971	Integrin-linked protein kinase
14	9606.ENSP00000284240	0.968	Thy-1 membrane glycoprotein
15	9606.ENSP00000267082	0.966	Integrin beta-7
16	9606.ENSP00000355361	0.966	Leukocyte surface antigen CD47
17	9606.ENSP00000362680	0.963	Proto-oncogene tyrosine-protein kinase Src
18	9606.ENSP00000296591	0.962	EGF-like repeat and discoidin I-like domain-containing protein 3
19	9606.ENSP00000339328	0.962	Urokinase plasminogen activator surface receptor
20	9606.ENSP00000364133	0.961	TGF-beta receptor type-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0044877	0.963	protein-containing complex binding
GO:0050839	0.735	cell adhesion molecule binding
GO:0001968	0.611	fibronectin binding
GO:0019899	0.349	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.994	multicellular organismal process
GO:0009987	0.994	cellular process
GO:0048856	0.989	anatomical structure development
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0048518	0.955	positive regulation of biological process
GO:0007275	0.939	multicellular organism development
GO:0009653	0.911	anatomical structure morphogenesis
GO:0048870	0.873	cell motility
GO:0048731	0.866	system development
GO:0051716	0.830	cellular response to stimulus
GO:0065008	0.803	regulation of biological quality
GO:0048646	0.797	anatomical structure formation involved in morphogenesis
GO:0008284	0.779	positive regulation of cell population proliferation
GO:0007155	0.775	cell adhesion
GO:0072359	0.769	circulatory system development
GO:0007165	0.766	signal transduction
GO:0001944	0.728	vasculature development
GO:0030154	0.727	cell differentiation
GO:0001568	0.720	blood vessel development
GO:0007166	0.713	cell surface receptor signaling pathway
GO:0042221	0.693	response to chemical
GO:0016477	0.608	cell migration
GO:0048583	0.551	regulation of response to stimulus
GO:0035295	0.547	tube development
GO:0048519	0.517	negative regulation of biological process
GO:0023051	0.496	regulation of signaling
GO:0010646	0.496	regulation of cell communication
GO:0051239	0.494	regulation of multicellular organismal process
GO:0048523	0.482	negative regulation of cellular process
GO:0019222	0.476	regulation of metabolic process
GO:0009966	0.470	regulation of signal transduction
GO:2000145	0.439	regulation of cell motility
GO:0071840	0.430	cellular component organization or biogenesis
GO:0048584	0.421	positive regulation of response to stimulus
GO:0030334	0.417	regulation of cell migration
GO:0060255	0.410	regulation of macromolecule metabolic process
GO:0030155	0.399	regulation of cell adhesion
GO:0016043	0.388	cellular component organization
GO:0030335	0.346	positive regulation of cell migration
GO:0031323	0.334	regulation of cellular metabolic process
GO:0051171	0.333	regulation of nitrogen compound metabolic process
GO:0080090	0.328	regulation of primary metabolic process
GO:0009893	0.318	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0032991	0.992	protein-containing complex
GO:0098636	0.981	protein complex involved in cell adhesion
GO:0098797	0.979	plasma membrane protein complex
GO:0043235	0.978	receptor complex
GO:0005737	0.975	cytoplasm
GO:0098802	0.968	plasma membrane signaling receptor complex
GO:0005829	0.965	cytosol
GO:0008305	0.961	integrin complex
GO:0012505	0.920	endomembrane system
GO:0009986	0.900	cell surface
GO:0005576	0.892	extracellular region
GO:0031982	0.892	vesicle
GO:0005615	0.825	extracellular space
GO:0030055	0.817	cell-substrate junction
GO:0005925	0.736	focal adhesion
GO:0043231	0.723	intracellular membrane-bounded organelle
GO:0070013	0.376	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]