StarFunc result for job id P06865

User Input

>input (529 residues)
MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSV
LDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTI
NDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHY
LPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVK
EVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEF
MSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLL
DIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPW
YLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV
AERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQEFEQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H3BP20	0.990	0.970	0.000	540	1.000	0.980	H3BP20.pdb.gz	H3BP20_HUMAN Beta-hexosaminidase OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=1
2	AFDB:P29416	0.991	0.993	1.077E-102	528	0.841	0.843	P29416.pdb.gz	HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus musculus OX=10090 GN=Hexa PE=1 SV=2
3	PDB:2gjxA	0.923	0.993	2.772E-94	492	0.907	0.976	2gjxA.pdb.gz
4	AFDB:A2BHD8	0.932	0.911	1.037E-80	541	0.561	0.549	A2BHD8.pdb.gz	A2BHD8_DANRE Beta-hexosaminidase OS=Danio rerio OX=7955 GN=fc04h11 PE=1 SV=1
5	AFDB:P07686	0.925	0.881	4.757E-78	556	0.552	0.525	P07686.pdb.gz	HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=4
6	AFDB:P20060	0.925	0.913	7.490E-78	536	0.531	0.524	P20060.pdb.gz	HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus musculus OX=10090 GN=Hexb PE=1 SV=2
7	AFDB:Q6AXR4	0.927	0.914	5.777E-77	537	0.522	0.514	Q6AXR4.pdb.gz	HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus OX=10116 GN=Hexb PE=2 SV=1
8	PDB:5broA	0.913	0.986	1.205E-72	490	0.550	0.594	5broA.pdb.gz
9	AFDB:Q22492	0.882	0.842	9.806E-55	555	0.393	0.375	Q22492.pdb.gz	HEXA_CAEEL Beta-hexosaminidase A OS=Caenorhabditis elegans OX=6239 GN=hex-1 PE=1 SV=1
10	AFDB:P13723	0.859	0.854	1.220E-52	532	0.321	0.320	P13723.pdb.gz	HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum OX=44689 GN=hexa1 PE=1 SV=1
11	AFDB:Q8L7S6	0.848	0.839	1.011E-48	535	0.346	0.342	Q8L7S6.pdb.gz	HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana OX=3702 GN=HEXO3 PE=1 SV=1
12	AFDB:A7WM73	0.839	0.821	1.160E-47	541	0.333	0.325	A7WM73.pdb.gz	HEXO1_ARATH Beta-hexosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=HEXO1 PE=1 SV=1
13	PDB:6k35A	0.772	0.643	9.431E-36	640	0.242	0.200	6k35A.pdb.gz	NAG-thiazoline is a potent inhibitor of the Vibrio campbellii GH20 beta-N-Acetylglucosaminidase.
14	PDB:6je8A	0.699	0.784	1.367E-29	469	0.225	0.254	6je8A.pdb.gz	Crystallographic evidence for substrate-assisted catalysis of beta-N-acetylhexosaminidas from Akkermansia muciniphila.
15	PDB:5fl1A	0.519	0.402	2.126E-13	703	0.134	0.101	5fl1A.pdb.gz	Analysis of transition state mimicry by tight binding aminothiazoline inhibitors provides insight into catalysis by humanO-GlcNAcase.
16	PDB:1mqrA	0.496	0.404	2.090E-9	674	0.132	0.104	1mqrA.pdb.gz
17	PDB:1gqiA	0.459	0.361	7.707E-9	708	0.146	0.109	1gqiA.pdb.gz	The Structural Basis for Catalysis and Specificity of the Pseudomonas Cellulosa Alpha-Glucuronidase, Glca67A
18	PDB:3k1dA	0.281	0.218	1.137E-6	722	0.085	0.062	3k1dA.pdb.gz
19	PDB:7p44B	0.321	0.257	1.510E-6	700	0.096	0.073	7p44B.pdb.gz
20	PDB:2f2hA	0.277	0.205	2.516E-6	773	0.068	0.047	2f2hA.pdb.gz	Expanding the Thioglycoligase Strategy to the Synthesis of alpha-linked Thioglycosides Allows Structural Investigation of the Parent Enzyme/Substrate Complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3W3	0.0	1096	529	1.000	1.000	A0A0S2Z3W3_HUMAN beta-N-acetylhexosaminidase (Fragment) OS=Homo sapiens OX=9606 GN=HEXA PE=2 SV=1
2	A2BHD8	0.0	600	541	0.558	0.545	A2BHD8_DANRE Beta-hexosaminidase OS=Danio rerio OX=7955 GN=fc04h11 PE=1 SV=1
3	H3BP20	0.0	1085	540	1.000	0.980	H3BP20_HUMAN Beta-hexosaminidase OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=1
4	H3BS10	0.0	1053	509	0.962	1.000	H3BS10_HUMAN Beta-hexosaminidase OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=1
5	P06865	0.0	1096	529	1.000	1.000	HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=2
6	P07686	0.0	605	556	0.552	0.525	HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=4
7	P20060	0.0	592	536	0.537	0.530	HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus musculus OX=10090 GN=Hexb PE=1 SV=2
8	P29416	0.0	917	528	0.841	0.843	HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus musculus OX=10090 GN=Hexa PE=1 SV=2
9	Q6AXR4	0.0	595	537	0.544	0.536	HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus OX=10116 GN=Hexb PE=2 SV=1
10	F1QUU0	5.08e-168	485	464	0.459	0.524	F1QUU0_DANRE beta-N-acetylhexosaminidase OS=Danio rerio OX=7955 GN=fc04h11 PE=1 SV=1
11	Q22492	6.61e-116	355	555	0.405	0.386	HEXA_CAEEL Beta-hexosaminidase A OS=Caenorhabditis elegans OX=6239 GN=hex-1 PE=1 SV=1
12	P13723	6.34e-97	305	532	0.329	0.327	HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum OX=44689 GN=hexa1 PE=1 SV=1
13	Q8L7S6	1.38e-86	279	535	0.308	0.305	HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana OX=3702 GN=HEXO3 PE=1 SV=1
14	A7WM73	5.49e-85	275	541	0.338	0.331	HEXO1_ARATH Beta-hexosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=HEXO1 PE=1 SV=1
15	Q9SYK0	3.42e-78	258	580	0.357	0.326	HEXO2_ARATH Beta-hexosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=HEXO2 PE=1 SV=1
16	Q9W3C4	4.76e-72	243	622	0.340	0.289	Q9W3C4_DROME beta-N-acetylhexosaminidase OS=Drosophila melanogaster OX=7227 GN=Hexo2 PE=1 SV=1
17	P49010	9.34e-62	215	596	0.282	0.250	HEXC_BOMMO Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Bombyx mori OX=7091 PE=1 SV=1
18	Q2URY6	1.66e-59	209	600	0.272	0.240	Q2URY6_ASPOR Beta-hexosaminidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000639 PE=3 SV=1
19	A0A1D8PNR7	1.11e-58	206	562	0.308	0.290	A0A1D8PNR7_CANAL Beta-hexosaminidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HEX1 PE=3 SV=1
20	Q8IRB6	1.16e-58	207	606	0.287	0.251	Q8IRB6_DROME beta-N-acetylhexosaminidase OS=Drosophila melanogaster OX=7227 GN=Hexo1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14845 Glycohydro_20b2	6e-20	83.7	beta-acetyl hexosaminidase like
2	PF00728 Glyco_hydro_20	3.3e-81	284.9	Glycosyl hydrolase family 20, catalytic domain
3	PF02838 Glyco_hydro_20b	35	16.6	Glycosyl hydrolase family 20, domain 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268097

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349687	0.989	Ganglioside GM2 activator
2	9606.ENSP00000261416	0.988	Beta-hexosaminidase subunit beta
3	9606.ENSP00000306920	0.969	Beta-galactosidase
4	9606.ENSP00000379680	0.963	Alpha-N-acetylgalactosaminidase
5	9606.ENSP00000218516	0.956	Galactosidase alpha
6	9606.ENSP00000258145	0.940	N-acetylglucosamine-6-sulfatase
7	9606.ENSP00000356198	0.935	Chitotriosidase-1
8	9606.ENSP00000477639	0.927	N-acetyl-D-glucosamine kinase
9	9606.ENSP00000358755	0.926	Acidic mammalian chitinase
10	9606.ENSP00000366549	0.921	Lactosylceramide alpha-2,3-sialyltransferase
11	9606.ENSP00000379353	0.917	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
12	9606.ENSP00000377303	0.915	N-acylglucosamine 2-epimerase
13	9606.ENSP00000384794	0.904	Lactosylceramide 4-alpha-galactosyltransferase
14	9606.ENSP00000381699	0.903	Beta-1,3-galactosyltransferase 5
15	9606.ENSP00000390784	0.903	Beta-1,3-galactosyltransferase 4
16	9606.ENSP00000361110	0.900	Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
17	9606.ENSP00000337854	0.858	Hexosaminidase D
18	9606.ENSP00000363603	0.852	Tissue alpha-L-fucosidase
19	9606.ENSP00000341562	0.832	Beta-1,4 N-acetylgalactosaminyltransferase 1
20	9606.ENSP00000002165	0.830	Plasma alpha-L-fucosidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004563	1.000	beta-N-acetylhexosaminidase activity
GO:0005515	0.978	protein binding
GO:0016740	0.823	transferase activity
GO:0016757	0.777	glycosyltransferase activity
GO:0016758	0.675	hexosyltransferase activity
GO:0008194	0.553	UDP-glycosyltransferase activity
GO:0008375	0.363	acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:1901575	0.994	organic substance catabolic process
GO:0006665	0.986	sphingolipid metabolic process
GO:0006664	0.986	glycolipid metabolic process
GO:0006687	0.983	glycosphingolipid metabolic process
GO:0043170	0.981	macromolecule metabolic process
GO:0006672	0.979	ceramide metabolic process
GO:0030149	0.977	sphingolipid catabolic process
GO:0006022	0.974	aminoglycan metabolic process
GO:1901136	0.973	carbohydrate derivative catabolic process
GO:0030203	0.962	glycosaminoglycan metabolic process
GO:0005975	0.429	carbohydrate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.993	cytosol
GO:0043233	0.855	organelle lumen
GO:0005576	0.840	extracellular region
GO:0070013	0.816	intracellular organelle lumen
GO:0016020	0.646	membrane
GO:0005615	0.564	extracellular space
GO:0031982	0.551	vesicle
GO:0043230	0.511	extracellular organelle
GO:1903561	0.482	extracellular vesicle
GO:0070062	0.441	extracellular exosome
GO:0012505	0.387	endomembrane system
GO:0005773	0.327	vacuole
GO:0005764	0.318	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.52	1.000	beta-N-acetylhexosaminidase.
EC:2.-.-.-	0.823	Transferases.
EC:2.4.-.-	0.777	Glycosyltransferases.
EC:2.4.1.-	0.675	Hexosyltransferases.

[back to server]