StarFunc result for job id P07093

User Input

>input (398 residues)
MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIAS
VLGMLQLGADGRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNAS
EIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTR
LVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPMLAQLSVFRCGSTSAPNDLWYN
FIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA
QTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSEDGTKASAATTA
ILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07093	1.000	1.000	4.590E-87	398	1.000	1.000	P07093.pdb.gz	GDN_HUMAN Glia-derived nexin OS=Homo sapiens OX=9606 GN=SERPINE2 PE=1 SV=1
2	AFDB:P07092	0.944	0.946	3.608E-73	397	0.837	0.839	P07092.pdb.gz	GDN_RAT Glia-derived nexin OS=Rattus norvegicus OX=10116 GN=Serpine2 PE=1 SV=1
3	PDB:4dy7F	0.925	0.973	7.920E-72	378	0.950	1.000	4dy7F.pdb.gz	Crystal structures of protease nexin-1 in complex with heparin and thrombin suggest a 2-step recognition mechanism.
4	AFDB:P13909	0.900	0.891	2.428E-49	402	0.402	0.398	P13909.pdb.gz	PAI1_BOVIN Plasminogen activator inhibitor 1 OS=Bos taurus OX=9913 GN=SERPINE1 PE=1 SV=1
5	AFDB:P05121	0.919	0.910	4.856E-49	402	0.407	0.403	P05121.pdb.gz	PAI1_HUMAN Plasminogen activator inhibitor 1 OS=Homo sapiens OX=9606 GN=SERPINE1 PE=1 SV=1
6	AFDB:P22777	0.903	0.894	1.155E-48	402	0.369	0.366	P22777.pdb.gz	PAI1_MOUSE Plasminogen activator inhibitor 1 OS=Mus musculus OX=10090 GN=Serpine1 PE=1 SV=1
7	AFDB:P20961	0.902	0.893	4.893E-48	402	0.387	0.383	P20961.pdb.gz	PAI1_RAT Plasminogen activator inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Serpine1 PE=2 SV=1
8	AFDB:F1QRB8	0.894	0.907	2.976E-45	392	0.364	0.370	F1QRB8.pdb.gz	F1QRB8_DANRE Plasminogen activator inhibitor 1 OS=Danio rerio OX=7955 GN=PAI-1 PE=1 SV=1
9	PDB:4dteA	0.887	0.943	5.147E-45	374	0.364	0.388	4dteA.pdb.gz
10	AFDB:O35684	0.863	0.839	1.069E-43	410	0.342	0.332	O35684.pdb.gz	NEUS_MOUSE Neuroserpin OS=Mus musculus OX=10090 GN=Serpini1 PE=1 SV=1
11	AFDB:Q90935	0.867	0.842	5.120E-42	410	0.344	0.334	Q90935.pdb.gz	NEUS_CHICK Neuroserpin OS=Gallus gallus OX=9031 GN=SERPINI1 PE=1 SV=1
12	AFDB:G3V7A3	0.858	0.844	2.169E-41	405	0.312	0.306	G3V7A3.pdb.gz	G3V7A3_RAT Serpin family I member 2 OS=Rattus norvegicus OX=10116 GN=Serpini2 PE=3 SV=1
13	PDB:3f5nB	0.829	0.875	3.650E-37	376	0.319	0.338	3f5nB.pdb.gz
14	PDB:4aqhB	0.829	0.860	3.650E-37	383	0.387	0.402	4aqhB.pdb.gz	Characterization of a Small Molecule Inhibitor of Plasminogen Activator Inhibitor Type 1 that Accelerates the Transition Into the Latent Conformation
15	PDB:4ga7A	0.853	0.918	3.650E-37	369	0.291	0.314	4ga7A.pdb.gz
16	PDB:2zv6B	0.834	0.892	6.137E-37	371	0.302	0.323	2zv6B.pdb.gz
17	PDB:3f1sA	0.849	0.876	1.546E-36	385	0.274	0.283	3f1sA.pdb.gz
18	PDB:2h4rA	0.824	0.882	2.187E-36	371	0.284	0.305	2h4rA.pdb.gz
19	PDB:2ol2A	0.813	0.895	5.200E-36	360	0.251	0.278	2ol2A.pdb.gz
20	PDB:1xqgA	0.855	0.898	1.040E-35	378	0.234	0.246	1xqgA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07092	0.0	702	397	0.837	0.839	GDN_RAT Glia-derived nexin OS=Rattus norvegicus OX=10116 GN=Serpine2 PE=1 SV=1
2	P07093	0.0	818	398	1.000	1.000	GDN_HUMAN Glia-derived nexin OS=Homo sapiens OX=9606 GN=SERPINE2 PE=1 SV=1
3	Q07235	0.0	710	397	0.849	0.851	GDN_MOUSE Glia-derived nexin OS=Mus musculus OX=10090 GN=Serpine2 PE=1 SV=2
4	P05121	6.56e-100	304	402	0.394	0.391	PAI1_HUMAN Plasminogen activator inhibitor 1 OS=Homo sapiens OX=9606 GN=SERPINE1 PE=1 SV=1
5	P13909	3.22e-99	302	402	0.389	0.386	PAI1_BOVIN Plasminogen activator inhibitor 1 OS=Bos taurus OX=9913 GN=SERPINE1 PE=1 SV=1
6	P20961	1.82e-93	288	402	0.374	0.371	PAI1_RAT Plasminogen activator inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Serpine1 PE=2 SV=1
7	P22777	5.56e-90	279	402	0.362	0.358	PAI1_MOUSE Plasminogen activator inhibitor 1 OS=Mus musculus OX=10090 GN=Serpine1 PE=1 SV=1
8	F1QRB8	2.05e-87	272	392	0.377	0.383	F1QRB8_DANRE Plasminogen activator inhibitor 1 OS=Danio rerio OX=7955 GN=PAI-1 PE=1 SV=1
9	A8WGQ0	4.75e-85	266	384	0.372	0.385	A8WGQ0_DANRE Plasminogen activator inhibitor 1 precursor OS=Danio rerio OX=7955 GN=si:ch211-138a11.1 PE=2 SV=1
10	O35684	2.78e-78	249	410	0.342	0.332	NEUS_MOUSE Neuroserpin OS=Mus musculus OX=10090 GN=Serpini1 PE=1 SV=1
11	Q99574	5.65e-76	243	410	0.329	0.320	NEUS_HUMAN Neuroserpin OS=Homo sapiens OX=9606 GN=SERPINI1 PE=1 SV=1
12	Q90935	1.11e-75	242	410	0.339	0.329	NEUS_CHICK Neuroserpin OS=Gallus gallus OX=9031 GN=SERPINI1 PE=1 SV=1
13	Q9JLD2	2.95e-74	238	410	0.332	0.322	NEUS_RAT Neuroserpin OS=Rattus norvegicus OX=10116 GN=Serpini1 PE=1 SV=1
14	O75830	3.30e-68	223	405	0.314	0.309	SPI2_HUMAN Serpin I2 OS=Homo sapiens OX=9606 GN=SERPINI2 PE=1 SV=1
15	G3V7A3	3.62e-66	218	405	0.319	0.314	G3V7A3_RAT Serpin family I member 2 OS=Rattus norvegicus OX=10116 GN=Serpini2 PE=3 SV=1
16	Q9JK88	1.45e-64	213	405	0.304	0.299	SPI2_MOUSE Serpin I2 OS=Mus musculus OX=10090 GN=Serpini2 PE=1 SV=1
17	Q6P217	5.82e-55	187	377	0.317	0.334	Q6P217_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9b OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
18	Q9DAV6	5.94e-55	187	377	0.317	0.334	Q9DAV6_MOUSE R86 OS=Mus musculus OX=10090 GN=Serpinb9b PE=1 SV=1
19	Q8MPN6	2.72e-54	186	379	0.299	0.314	Q8MPN6_DROME Serpin 4 OS=Drosophila melanogaster OX=7227 GN=Spn42Da PE=1 SV=1
20	Q9D154	3.36e-54	186	379	0.329	0.346	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00079 Serpin	2.5e-102	354.6	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000000961

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000006823	0.973	Prothrombin
2	9593.ENSGGOP00000014897	0.917	Plasminogen activator, urokinase
3	9593.ENSGGOP00000024702	0.888	Plasminogen activator, tissue
4	9593.ENSGGOP00000008970	0.878	Uncharacterized protein
5	9593.ENSGGOP00000020923	0.773	Transglutaminase 4
6	9593.ENSGGOP00000010821	0.743	Vitronectin
7	9593.ENSGGOP00000009976	0.741	Low density lipoprotein receptor-related protein 1
8	9593.ENSGGOP00000010048	0.736	Plasminogen
9	9593.ENSGGOP00000001180	0.693	Coagulation factor XIII, A1 polypeptide
10	9593.ENSGGOP00000011675	0.691	Histocompatibility (minor) serpin domain containing
11	9593.ENSGGOP00000025063	0.690	Growth arrest-specific 8
12	9593.ENSGGOP00000003549	0.689	Coagulation factor VIII, procoagulant component
13	9593.ENSGGOP00000015684	0.679	Lipoprotein(a)
14	9593.ENSGGOP00000021562	0.679	Uncharacterized protein
15	9593.ENSGGOP00000007027	0.673	Serpin family E member 1
16	9593.ENSGGOP00000013747	0.669	Coagulation factor X
17	9593.ENSGGOP00000010440	0.668	Coagulation factor V (proaccelerin, labile factor)
18	9593.ENSGGOP00000002259	0.662	Hyaluronan binding protein 2
19	9593.ENSGGOP00000010796	0.646	Sorting nexin 1
20	9593.ENSGGOP00000016059	0.639	Coagulation factor XIII, B polypeptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0005102	0.917	signaling receptor binding
GO:0005539	0.317	glycosaminoglycan binding
GO:1901681	0.316	sulfur compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0051241	0.987	negative regulation of multicellular organismal process
GO:0061041	0.987	regulation of wound healing
GO:0050878	0.986	regulation of body fluid levels
GO:0050818	0.986	regulation of coagulation
GO:0032102	0.986	negative regulation of response to external stimulus
GO:0030193	0.979	regulation of blood coagulation
GO:0080090	0.975	regulation of primary metabolic process
GO:0030195	0.971	negative regulation of blood coagulation
GO:0045861	0.969	negative regulation of proteolysis
GO:0050794	0.947	regulation of cellular process
GO:0009987	0.915	cellular process
GO:0048518	0.876	positive regulation of biological process
GO:1903317	0.865	regulation of protein maturation
GO:0070613	0.851	regulation of protein processing
GO:1903318	0.798	negative regulation of protein maturation
GO:0048522	0.732	positive regulation of cellular process
GO:0032501	0.728	multicellular organismal process
GO:0050793	0.596	regulation of developmental process
GO:0050896	0.587	response to stimulus
GO:0051240	0.555	positive regulation of multicellular organismal process
GO:0071840	0.522	cellular component organization or biogenesis
GO:0010955	0.515	negative regulation of protein processing
GO:0016043	0.474	cellular component organization
GO:0048523	0.445	negative regulation of cellular process
GO:0048856	0.435	anatomical structure development
GO:2000026	0.431	regulation of multicellular organismal development
GO:0007275	0.351	multicellular organism development
GO:0008152	0.349	metabolic process
GO:0071704	0.313	organic substance metabolic process
GO:0006950	0.309	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043227	0.829	membrane-bounded organelle
GO:0005737	0.829	cytoplasm
GO:0005615	0.799	extracellular space
GO:0016020	0.792	membrane
GO:0071944	0.777	cell periphery
GO:0043229	0.772	intracellular organelle
GO:0043231	0.707	intracellular membrane-bounded organelle
GO:0012505	0.549	endomembrane system
GO:0031982	0.429	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]