StarFunc result for job id P07148

User Input

>input (127 residues)
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07148	1.000	1.000	6.751E-22	127	1.000	1.000	P07148.pdb.gz	FABPL_HUMAN Fatty acid-binding protein, liver OS=Homo sapiens OX=9606 GN=FABP1 PE=1 SV=1
2	AFDB:P02692	0.994	0.994	6.540E-19	127	0.827	0.827	P02692.pdb.gz	FABPL_RAT Fatty acid-binding protein, liver OS=Rattus norvegicus OX=10116 GN=Fabp1 PE=1 SV=1
3	PDB:6mp4E	0.969	0.900	8.477E-19	137	1.000	0.927	6mp4E.pdb.gz	Liver fatty acid-binding protein regulates THC metabolism by facilitating intracellular hepatic transport
4	PDB:1lfoA	0.986	0.978	5.741E-18	128	0.827	0.820	1lfoA.pdb.gz	The crystal structure of the liver fatty acid-binding protein. A complex with two bound oleates.
5	AFDB:Q4VBT1	0.980	0.972	1.607E-15	128	0.598	0.594	Q4VBT1.pdb.gz	FA1B1_DANRE Fatty acid binding protein 1-B.1 OS=Danio rerio OX=7955 GN=fabp1b.1 PE=2 SV=1
6	AFDB:Q9I8L5	0.941	0.948	1.478E-12	126	0.425	0.429	Q9I8L5.pdb.gz	FA10A_DANRE Fatty acid-binding protein 10-A, liver basic OS=Danio rerio OX=7955 GN=fabp10a PE=1 SV=1
7	AFDB:P51161	0.956	0.948	1.639E-12	128	0.362	0.359	P51161.pdb.gz	FABP6_HUMAN Gastrotropin OS=Homo sapiens OX=9606 GN=FABP6 PE=1 SV=2
8	PDB:2qo5A	0.920	0.906	1.641E-12	129	0.425	0.419	2qo5A.pdb.gz
9	AFDB:P51162	0.950	0.943	2.749E-12	128	0.402	0.398	P51162.pdb.gz	FABP6_MOUSE Gastrotropin OS=Mus musculus OX=10090 GN=Fabp6 PE=2 SV=2
10	AFDB:A0A0R4IRM6	0.905	0.899	2.815E-11	128	0.409	0.406	A0A0R4IRM6.pdb.gz	A0A0R4IRM6_DANRE Fatty acid-binding protein, liver OS=Danio rerio OX=7955 GN=fabp1b.2 PE=3 SV=1
11	AFDB:B2ZHD9	0.915	0.889	4.972E-11	131	0.409	0.397	B2ZHD9.pdb.gz
12	PDB:2mm3A	0.876	0.876	5.811E-11	127	0.362	0.362	2mm3A.pdb.gz	Structural determinants of ligand binding in the ternary complex of human ileal bile acid binding protein with glycocholate and glycochenodeoxycholate obtained from solution NMR
13	PDB:3elzB	0.847	0.801	9.745E-11	135	0.409	0.385	3elzB.pdb.gz	The X-Ray structure of zebrafish (Danio rerio) ileal bile acid-binding protein reveals the presence of binding sites on the surface of the protein molecule.
14	PDB:5ggeA	0.892	0.879	2.116E-10	129	0.307	0.302	5ggeA.pdb.gz
15	AFDB:Q8IGA2	0.912	0.821	4.361E-10	142	0.315	0.282	Q8IGA2.pdb.gz	Q8IGA2_DROME SD12036p (Fragment) OS=Drosophila melanogaster OX=7227 GN=fabp PE=2 SV=1
16	AFDB:B0FLN8	0.882	0.822	5.092E-10	137	0.291	0.270	B0FLN8.pdb.gz	B0FLN8_CHICK Cellular retinoic acid binding protein I OS=Gallus gallus OX=9031 GN=CRABP-I PE=2 SV=1
17	PDB:7ry5BBB	0.891	0.798	5.952E-10	143	0.323	0.287	7ry5BBB.pdb.gz	Development of an Enzyme-Inhibitor Reaction Using Cellular Retinoic Acid Binding Protein II for One-Pot Megamolecule Assembly.
18	PDB:7a9yAAA	0.888	0.828	7.707E-10	137	0.291	0.270	7a9yAAA.pdb.gz	Structure-functional relationship of cellular retinoic acid-binding proteins I and II interacting with natural and synthetic ligands.
19	PDB:2rctA	0.903	0.819	1.292E-9	141	0.291	0.262	2rctA.pdb.gz	Crystal structure of human cellular retinol-binding protein II to 1.2 A resolution.
20	PDB:5hz9A	0.892	0.843	3.278E-9	135	0.283	0.267	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07148	1.50e-87	252	127	1.000	1.000	FABPL_HUMAN Fatty acid-binding protein, liver OS=Homo sapiens OX=9606 GN=FABP1 PE=1 SV=1
2	Q6FGL7	1.50e-87	252	127	1.000	1.000	Q6FGL7_HUMAN Fatty acid-binding protein, liver (Fragment) OS=Homo sapiens OX=9606 GN=FABP1 PE=2 SV=1
3	A8MW49	1.21e-75	221	124	0.874	0.895	A8MW49_HUMAN Fatty acid-binding protein, liver OS=Homo sapiens OX=9606 GN=FABP1 PE=1 SV=1
4	P12710	5.80e-74	218	127	0.843	0.843	FABPL_MOUSE Fatty acid-binding protein, liver OS=Mus musculus OX=10090 GN=Fabp1 PE=1 SV=2
5	P02692	1.13e-72	214	127	0.827	0.827	FABPL_RAT Fatty acid-binding protein, liver OS=Rattus norvegicus OX=10116 GN=Fabp1 PE=1 SV=1
6	Q4VBT1	2.72e-49	155	128	0.598	0.594	FA1B1_DANRE Fatty acid binding protein 1-B.1 OS=Danio rerio OX=7955 GN=fabp1b.1 PE=2 SV=1
7	P80020	2.74e-35	120	128	0.402	0.398	FABP6_RAT Gastrotropin OS=Rattus norvegicus OX=10116 GN=Fabp6 PE=1 SV=3
8	P51162	2.32e-34	117	128	0.402	0.398	FABP6_MOUSE Gastrotropin OS=Mus musculus OX=10090 GN=Fabp6 PE=2 SV=2
9	Q9I8L5	1.31e-29	105	126	0.425	0.429	FA10A_DANRE Fatty acid-binding protein 10-A, liver basic OS=Danio rerio OX=7955 GN=fabp10a PE=1 SV=1
10	P51161	1.40e-27	100	128	0.370	0.367	FABP6_HUMAN Gastrotropin OS=Homo sapiens OX=9606 GN=FABP6 PE=1 SV=2
11	Q6IMW5	4.53e-27	99.4	131	0.425	0.412	Q6IMW5_DANRE Fatty acid-binding protein 6, ileal (gastrotropin) OS=Danio rerio OX=7955 GN=zgc:92421 PE=1 SV=1
12	A0A0R4IRM6	3.77e-23	89.0	128	0.402	0.398	A0A0R4IRM6_DANRE Fatty acid-binding protein, liver OS=Danio rerio OX=7955 GN=fabp1b.2 PE=3 SV=1
13	P29373	1.16e-09	54.7	138	0.346	0.319	RABP2_HUMAN Cellular retinoic acid-binding protein 2 OS=Homo sapiens OX=9606 GN=CRABP2 PE=1 SV=2
14	P29762	2.33e-08	51.2	137	0.299	0.277	RABP1_HUMAN Cellular retinoic acid-binding protein 1 OS=Homo sapiens OX=9606 GN=CRABP1 PE=1 SV=2
15	B0FLN8	2.82e-08	50.8	137	0.291	0.270	B0FLN8_CHICK Cellular retinoic acid binding protein I OS=Gallus gallus OX=9031 GN=CRABP-I PE=2 SV=1
16	P40220	2.82e-08	50.8	137	0.291	0.270	RABP1_CHICK Cellular retinoic acid-binding protein 1 OS=Gallus gallus OX=9031 GN=CRABP1 PE=2 SV=4
17	P62964	4.11e-08	50.4	137	0.299	0.277	RABP1_BOVIN Cellular retinoic acid-binding protein 1 OS=Bos taurus OX=9913 GN=CRABP1 PE=1 SV=2
18	P62965	4.11e-08	50.4	137	0.299	0.277	RABP1_MOUSE Cellular retinoic acid-binding protein 1 OS=Mus musculus OX=10090 GN=Crabp1 PE=1 SV=2
19	P62966	4.11e-08	50.4	137	0.299	0.277	RABP1_RAT Cellular retinoic acid-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Crabp1 PE=1 SV=3
20	P22935	5.16e-08	50.4	138	0.323	0.297	RABP2_MOUSE Cellular retinoic acid-binding protein 2 OS=Mus musculus OX=10090 GN=Crabp2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	8.4e-11	53.7	Lipocalin / cytosolic fatty-acid binding protein family
2	PF14651 Lipocalin_7	3.1e-28	109.7	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295834

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385523	0.998	Peroxisome proliferator-activated receptor alpha
2	9606.ENSP00000236850	0.980	Apolipoprotein A-I
3	9606.ENSP00000293217	0.969	Peroxisomal acyl-coenzyme A oxidase 1
4	9606.ENSP00000265641	0.961	Carnitine O-palmitoyltransferase 1, liver isoform
5	9606.ENSP00000233242	0.953	Apolipoprotein B-100
6	9606.ENSP00000356969	0.952	Apolipoprotein A-II
7	9606.ENSP00000231887	0.951	Peroxisomal bifunctional enzyme
8	9606.ENSP00000309757	0.947	Lipoprotein lipase
9	9606.ENSP00000264867	0.938	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
10	9606.ENSP00000477707	0.937	Oxysterols receptor LXR-alpha
11	9606.ENSP00000274024	0.926	Fatty acid-binding protein, intestinal
12	9606.ENSP00000419692	0.926	Retinoic acid receptor RXR-alpha
13	9606.ENSP00000420914	0.922	Peroxisomal multifunctional enzyme type 2
14	9606.ENSP00000385216	0.913	Nuclear receptor coactivator 1
15	9606.ENSP00000358719	0.912	Malic enzyme 1
16	9606.ENSP00000360266	0.911	Transcription factor AP-1
17	9606.ENSP00000444198	0.908	Cbp/p300-interacting transactivator 2
18	9606.ENSP00000262367	0.906	CREB-binding protein
19	9606.ENSP00000263253	0.906	Histone acetyltransferase p300
20	9606.ENSP00000300651	0.905	Mediator of RNA polymerase II transcription subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0008289	0.995	lipid binding
GO:0036094	0.979	small molecule binding
GO:0033293	0.970	monocarboxylic acid binding
GO:0016209	0.820	antioxidant activity
GO:0005504	0.774	fatty acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0009987	0.977	cellular process
GO:0050794	0.976	regulation of cellular process
GO:0019222	0.916	regulation of metabolic process
GO:0080090	0.907	regulation of primary metabolic process
GO:0050896	0.841	response to stimulus
GO:0060255	0.815	regulation of macromolecule metabolic process
GO:0048519	0.813	negative regulation of biological process
GO:0051171	0.795	regulation of nitrogen compound metabolic process
GO:0051716	0.783	cellular response to stimulus
GO:0008152	0.761	metabolic process
GO:0006950	0.726	response to stress
GO:0010033	0.700	response to organic substance
GO:0044238	0.676	primary metabolic process
GO:0009892	0.620	negative regulation of metabolic process
GO:0065009	0.615	regulation of molecular function
GO:0051246	0.610	regulation of protein metabolic process
GO:0048523	0.595	negative regulation of cellular process
GO:0071704	0.580	organic substance metabolic process
GO:0051346	0.559	negative regulation of hydrolase activity
GO:0010605	0.551	negative regulation of macromolecule metabolic process
GO:0070887	0.543	cellular response to chemical stimulus
GO:0052547	0.524	regulation of peptidase activity
GO:0051172	0.523	negative regulation of nitrogen compound metabolic process
GO:0045861	0.512	negative regulation of proteolysis
GO:0048518	0.497	positive regulation of biological process
GO:0010941	0.476	regulation of cell death
GO:0010466	0.459	negative regulation of peptidase activity
GO:0031323	0.453	regulation of cellular metabolic process
GO:0006979	0.423	response to oxidative stress
GO:0032501	0.394	multicellular organismal process
GO:0048522	0.392	positive regulation of cellular process
GO:0044237	0.386	cellular metabolic process
GO:0033554	0.380	cellular response to stress
GO:0009893	0.321	positive regulation of metabolic process
GO:0052548	0.301	regulation of endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.999	cytosol
GO:0070013	0.999	intracellular organelle lumen
GO:0005654	0.986	nucleoplasm
GO:0005576	0.634	extracellular region
GO:0005615	0.578	extracellular space
GO:1903561	0.547	extracellular vesicle
GO:0070062	0.415	extracellular exosome
GO:0016020	0.392	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]