StarFunc result for job id P07196

User Input

>input (543 residues)
MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS
SGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA
ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEE
EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQY
AQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRA
AKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRT
TKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFG
RSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEE
KDKEEAEEEEAAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAK
KKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02547	0.398	0.394	8.917E-55	549	0.919	0.909	P02547.pdb.gz	NFL_PIG Neurofilament light polypeptide OS=Sus scrofa OX=9823 GN=NEFL PE=1 SV=3
2	AFDB:I6L9F6	0.252	0.458	5.858E-27	284	0.519	0.993	I6L9F6.pdb.gz	I6L9F6_HUMAN NEFL protein OS=Homo sapiens OX=9606 GN=NEFL PE=1 SV=1
3	AFDB:P35617	0.350	0.398	7.440E-25	470	0.420	0.485	P35617.pdb.gz	XNIF_XENLA Low molecular weight neuronal intermediate filament OS=Xenopus laevis OX=8355 PE=1 SV=1
4	AFDB:A2ATX5	0.339	0.382	4.039E-24	474	0.394	0.451	A2ATX5.pdb.gz	A2ATX5_DANRE Alpha-internexin OS=Danio rerio OX=7955 GN=si:ch211-67n3.6 PE=1 SV=1
5	AFDB:P87360	0.400	0.444	5.933E-24	471	0.401	0.463	P87360.pdb.gz
6	AFDB:F1QAM8	0.344	0.399	7.007E-21	455	0.361	0.431	F1QAM8.pdb.gz
7	AFDB:F1NJ08	0.383	0.438	3.261E-20	460	0.346	0.409	F1NJ08.pdb.gz
8	AFDB:P02543	0.366	0.408	5.173E-20	466	0.354	0.412	P02543.pdb.gz	VIME_PIG Vimentin OS=Sus scrofa OX=9823 GN=VIM PE=1 SV=2
9	AFDB:P17661	0.357	0.397	6.516E-20	470	0.359	0.415	P17661.pdb.gz	DESM_HUMAN Desmin OS=Homo sapiens OX=9606 GN=DES PE=1 SV=3
10	AFDB:P02542	0.384	0.435	1.639E-19	464	0.343	0.401	P02542.pdb.gz	DESM_CHICK Desmin OS=Gallus gallus OX=9031 GN=DES PE=1 SV=2
11	PDB:7r5jV0	0.102	0.193	5.894	273	0.079	0.158	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:3jb9W	0.134	0.166	8.657	426	0.052	0.066	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
13	PDB:3ghgI	0.087	0.114	9.349	394	0.037	0.051	3ghgI.pdb.gz	Crystal structure of human fibrinogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02547	0.0	854	549	0.853	0.843	NFL_PIG Neurofilament light polypeptide OS=Sus scrofa OX=9823 GN=NEFL PE=1 SV=3
2	P07196	0.0	1074	543	1.000	1.000	NFL_HUMAN Neurofilament light polypeptide OS=Homo sapiens OX=9606 GN=NEFL PE=1 SV=3
3	P08551	0.0	852	543	0.847	0.847	NFL_MOUSE Neurofilament light polypeptide OS=Mus musculus OX=10090 GN=Nefl PE=1 SV=5
4	P19527	0.0	857	542	0.849	0.851	NFL_RAT Neurofilament light polypeptide OS=Rattus norvegicus OX=10116 GN=Nefl PE=1 SV=3
5	Q29RE8	1.77e-179	519	579	0.514	0.482	Q29RE8_DANRE Neurofilament, light polypeptide OS=Danio rerio OX=7955 GN=nefl PE=1 SV=1
6	P35617	4.52e-136	404	470	0.389	0.449	XNIF_XENLA Low molecular weight neuronal intermediate filament OS=Xenopus laevis OX=8355 PE=1 SV=1
7	F1Q8F1	2.52e-132	395	469	0.398	0.461	F1Q8F1_DANRE Internexin neuronal intermediate filament protein, alpha b OS=Danio rerio OX=7955 GN=gefiltin PE=1 SV=1
8	A2ATX5	1.83e-131	393	474	0.405	0.464	A2ATX5_DANRE Alpha-internexin OS=Danio rerio OX=7955 GN=si:ch211-67n3.6 PE=1 SV=1
9	Q16352	8.14e-130	389	499	0.401	0.437	AINX_HUMAN Alpha-internexin OS=Homo sapiens OX=9606 GN=INA PE=1 SV=2
10	P23565	7.83e-125	377	505	0.374	0.402	AINX_RAT Alpha-internexin OS=Rattus norvegicus OX=10116 GN=Ina PE=1 SV=2
11	P46660	3.53e-124	375	501	0.370	0.401	AINX_MOUSE Alpha-internexin OS=Mus musculus OX=10090 GN=Ina PE=1 SV=3
12	I6L9F6	6.62e-118	351	284	0.370	0.708	I6L9F6_HUMAN NEFL protein OS=Homo sapiens OX=9606 GN=NEFL PE=1 SV=1
13	Q9YHX5	2.08e-116	353	455	0.366	0.437	Q9YHX5_DANRE Vimentin OS=Danio rerio OX=7955 GN=cb28 PE=1 SV=1
14	P48674	3.91e-116	353	461	0.357	0.421	VIME_ONCMY Vimentin OS=Oncorhynchus mykiss OX=8022 GN=vim PE=2 SV=1
15	A0A060XL43	4.82e-114	347	449	0.344	0.416	A0A060XL43_ONCMY IF rod domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00043362001 PE=3 SV=1
16	P48616	6.02e-113	345	466	0.352	0.410	VIME_BOVIN Vimentin OS=Bos taurus OX=9913 GN=VIM PE=1 SV=3
17	P08670	1.85e-112	344	466	0.339	0.395	VIME_HUMAN Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4
18	V9HWE1	1.85e-112	344	466	0.339	0.395	V9HWE1_HUMAN Epididymis luminal protein 113 OS=Homo sapiens OX=9606 GN=HEL113 PE=2 SV=1
19	P02543	2.94e-112	343	466	0.339	0.395	VIME_PIG Vimentin OS=Sus scrofa OX=9823 GN=VIM PE=1 SV=2
20	E7EMV2	3.44e-110	345	698	0.396	0.308	E7EMV2_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07889 DUF1664	0.29	22.6	Protein of unknown function (DUF1664)
2	PF04504 DUF573	3.4e+02	13.3	Protein of unknown function, DUF573
3	PF00038 Filament	1.1e-97	339.0	Intermediate filament protein
4	PF04732 Filament_head	4.5e-08	45.1	Intermediate filament head (DNA binding) region
5	PF03954 Lectin_N	4.5e+02	12.1	Hepatic lectin, N-terminal domain
6	PF07926 TPR_MLP1_2	1.5	20.3	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482169

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221166	0.992	Neurofilament medium polypeptide
2	9606.ENSP00000345752	0.955	Myotubularin-related protein 2
3	9606.ENSP00000296526	0.948	Glutamate receptor 2
4	9606.ENSP00000428994	0.934	Glutamate receptor 1
5	9606.ENSP00000282499	0.927	Glutamate receptor 4
6	9606.ENSP00000481554	0.915	Glutamate receptor 3
7	9606.ENSP00000408979	0.913	Kinesin heavy chain isoform 5A
8	9606.ENSP00000270142	0.908	Superoxide dismutase [Cu-Zn]
9	9606.ENSP00000362680	0.907	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000407586	0.905	GTPase HRas
11	9606.ENSP00000256078	0.900	GTPase KRas
12	9606.ENSP00000358548	0.900	GTPase NRas
13	9606.ENSP00000393379	0.896	Kinesin heavy chain isoform 5C
14	9606.ENSP00000478767	0.866	Neurabin-2
15	9606.ENSP00000333982	0.852	Nuclear distribution protein nudE-like 1
16	9606.ENSP00000284981	0.840	Amyloid-beta A4 protein
17	9606.ENSP00000375810	0.830	Kinesin light chain 3
18	9606.ENSP00000353508	0.824	Microtubule-associated protein 2
19	9606.ENSP00000414982	0.821	Kinesin light chain 1
20	9606.ENSP00000307078	0.820	Kinesin-1 heavy chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.999	structural molecule activity
GO:0005200	0.993	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0032501	0.955	multicellular organismal process
GO:0045104	0.932	intermediate filament cytoskeleton organization
GO:0048856	0.928	anatomical structure development
GO:0050789	0.909	regulation of biological process
GO:0050794	0.903	regulation of cellular process
GO:0007017	0.859	microtubule-based process
GO:0030705	0.843	cytoskeleton-dependent intracellular transport
GO:0099111	0.839	microtubule-based transport
GO:0007275	0.837	multicellular organism development
GO:0010970	0.809	transport along microtubule
GO:0048731	0.762	system development
GO:0051646	0.758	mitochondrion localization
GO:0050896	0.722	response to stimulus
GO:0007399	0.705	nervous system development
GO:0051654	0.649	establishment of mitochondrion localization
GO:0008088	0.642	axo-dendritic transport
GO:0072384	0.547	organelle transport along microtubule
GO:0045109	0.545	intermediate filament organization
GO:0034643	0.465	establishment of mitochondrion localization, microtubule-mediated
GO:0098930	0.455	axonal transport
GO:0048518	0.406	positive regulation of biological process
GO:0051716	0.397	cellular response to stimulus
GO:0048522	0.358	positive regulation of cellular process
GO:0048519	0.317	negative regulation of biological process
GO:0048523	0.310	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005856	0.991	cytoskeleton
GO:0005882	0.979	intermediate filament
GO:0043231	0.767	intracellular membrane-bounded organelle
GO:0005829	0.606	cytosol
GO:0043005	0.556	neuron projection
GO:0030424	0.456	axon
GO:0071944	0.342	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]