StarFunc result for job id P07237

User Input

>input (508 residues)
MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALA
PEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGR
EADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAID
DIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEF
TEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQEL
PEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENI
VIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGD
DDDLEDLEEAEEPDMEEDDDQKAVKDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2HWU2	0.854	0.851	2.096E-100	510	0.982	0.978	Q2HWU2.pdb.gz	PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata OX=9543 GN=P4HB PE=2 SV=1
2	AFDB:I3L4M2	0.866	0.821	4.482E-92	537	0.906	0.857	I3L4M2.pdb.gz	I3L4M2_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
3	PDB:4ekzA	0.846	0.913	4.303E-89	469	0.892	0.966	4ekzA.pdb.gz
4	AFDB:H7BZ94	0.608	0.663	2.273E-88	464	0.911	0.998	H7BZ94.pdb.gz	H7BZ94_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
5	AFDB:H0Y3Z3	0.550	0.665	9.137E-78	418	0.821	0.998	H0Y3Z3.pdb.gz	H0Y3Z3_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
6	AFDB:Q1HGL1	0.920	0.935	1.028E-77	500	0.585	0.594	Q1HGL1.pdb.gz	Q1HGL1_CONMR Protein disulfide-isomerase OS=Conus marmoreus OX=42752 GN=MrPDI PE=2 SV=1
7	AFDB:A0A1S0S010	0.807	0.814	1.357E-75	503	0.563	0.569	A0A1S0S010.pdb.gz	A0A1S0S010_BRUMA Protein disulfide-isomerase OS=Brugia malayi OX=6279 GN=Bma-pdi-2 PE=2 SV=1
8	AFDB:Q17770	0.848	0.873	4.403E-75	493	0.549	0.566	Q17770.pdb.gz	PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans OX=6239 GN=pdi-2 PE=1 SV=1
9	AFDB:I3L514	0.675	0.740	1.638E-69	463	0.693	0.760	I3L514.pdb.gz	I3L514_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
10	AFDB:P54399	0.760	0.777	5.634E-69	496	0.535	0.548	P54399.pdb.gz	PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster OX=7227 GN=Pdi PE=2 SV=1
11	AFDB:Q13087	0.665	0.647	5.928E-68	525	0.470	0.455	Q13087.pdb.gz	PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens OX=9606 GN=PDIA2 PE=1 SV=2
12	PDB:3f8uA	0.546	0.581	1.656E-43	469	0.309	0.335	3f8uA.pdb.gz
13	PDB:3apoA	0.248	0.195	2.861E-23	688	0.157	0.116	3apoA.pdb.gz
14	PDB:5gu6A	0.415	0.528	3.387E-22	377	0.148	0.199	5gu6A.pdb.gz
15	PDB:5crgA	0.421	0.556	8.186E-22	354	0.138	0.198	5crgA.pdb.gz	Characterization of Two Human Skeletal Calsequestrin Mutants Implicated in Malignant Hyperthermia and Vacuolar Aggregate Myopathy.
16	PDB:7f05C	0.429	0.561	8.682E-22	355	0.144	0.206	7f05C.pdb.gz	Ca2+-dependent Formation of a Non-transmembrane Channel in a Calsequestrin-2 Dimer
17	PDB:2r2jA	0.407	0.589	3.750E-20	328	0.148	0.229	2r2jA.pdb.gz
18	PDB:4f9zA	0.267	0.555	8.545E-20	219	0.138	0.320	4f9zA.pdb.gz
19	PDB:3ed3A	0.209	0.384	3.546E-13	267	0.118	0.225	3ed3A.pdb.gz
20	PDB:7scdA	0.192	0.259	4.850E-8	371	0.122	0.167	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R8S5	0.0	1037	508	1.000	1.000	A0A024R8S5_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 PE=2 SV=1
2	A0A1S0S010	0.0	583	503	0.563	0.569	A0A1S0S010_BRUMA Protein disulfide-isomerase OS=Brugia malayi OX=6279 GN=Bma-pdi-2 PE=2 SV=1
3	H0Y3Z3	0.0	561	418	0.620	0.754	H0Y3Z3_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
4	H7BZ94	0.0	926	464	0.911	0.998	H7BZ94_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
5	I3L3P5	0.0	944	472	0.929	1.000	I3L3P5_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
6	I3L4M2	0.0	933	537	0.894	0.845	I3L4M2_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
7	I3L514	0.0	719	463	0.697	0.765	I3L514_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
8	P04785	0.0	933	509	0.919	0.917	PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus OX=10116 GN=P4hb PE=1 SV=2
9	P07237	0.0	1037	508	1.000	1.000	PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3
10	P09103	0.0	932	509	0.919	0.917	PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus OX=10090 GN=P4hb PE=1 SV=2
11	P54399	0.0	538	496	0.518	0.530	PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster OX=7227 GN=Pdi PE=2 SV=1
12	Q17770	0.0	575	493	0.539	0.556	PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans OX=6239 GN=pdi-2 PE=1 SV=1
13	Q1HGL1	0.0	583	500	0.565	0.574	Q1HGL1_CONMR Protein disulfide-isomerase OS=Conus marmoreus OX=42752 GN=MrPDI PE=2 SV=1
14	Q2HWU2	0.0	1016	510	0.982	0.978	PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata OX=9543 GN=P4HB PE=2 SV=1
15	Q13087	4.61e-164	477	525	0.449	0.434	PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens OX=9606 GN=PDIA2 PE=1 SV=2
16	D3Z6P0	3.05e-155	454	527	0.451	0.435	PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus OX=10090 GN=Pdia2 PE=1 SV=1
17	Q17967	1.26e-134	400	485	0.413	0.433	PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans OX=6239 GN=pdi-1 PE=3 SV=1
18	Q9FF55	8.92e-106	330	597	0.386	0.328	PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-4 PE=1 SV=1
19	O48949	1.07e-98	309	532	0.358	0.342	O48949_CHLRE Protein disulfide-isomerase OS=Chlamydomonas reinhardtii OX=3055 GN=PDI PE=2 SV=1
20	Q8VX13	7.27e-96	303	579	0.344	0.302	PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	2.2e-05	35.8	AhpC/TSA family
2	PF07912 ERp29_N	2.4e-06	39.2	ERp29, N-terminal domain
3	PF05768 Glrx-like	4.3e+02	12.7	Glutaredoxin-like domain (DUF836)
4	PF00462 Glutaredoxin	16	17.1	Glutaredoxin
5	PF02885 Glycos_trans_3N	4.6e+02	12.1	Glycosyl transferase family, helical bundle domain
6	PF07449 HyaE	48	15.4	Hydrogenase-1 expression protein HyaE
7	PF04756 OST3_OST6	1.2e-07	43.0	OST3 / OST6 family, transporter family
8	PF08534 Redoxin	0.23	22.6	Redoxin
9	PF00085 Thioredoxin	6e-59	207.8	Thioredoxin
10	PF13098 Thioredoxin_2	1.8e-10	52.6	Thioredoxin-like domain
11	PF13848 Thioredoxin_6	5.4e-44	161.8	Thioredoxin-like domain
12	PF13899 Thioredoxin_7	3.1e-08	45.0	Thioredoxin-like
13	PF13905 Thioredoxin_8	0.00077	31.0	Thioredoxin-like
14	PF14595 Thioredoxin_9	37	15.6	Thioredoxin
15	PF13728 TraF	4.4	18.6	F plasmid transfer operon protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327801

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320866	0.999	Calreticulin
2	9606.ENSP00000379042	0.999	ERO1-like protein alpha
3	9606.ENSP00000427679	0.999	Microsomal triglyceride transfer protein large subunit
4	9606.ENSP00000299767	0.995	Endoplasmin
5	9606.ENSP00000324173	0.995	78 kDa glucose-regulated protein
6	9606.ENSP00000300026	0.994	Peptidyl-prolyl cis-trans isomerase B
7	9606.ENSP00000265171	0.989	Pro-epidermal growth factor
8	9606.ENSP00000384999	0.989	Prolyl 4-hydroxylase subunit alpha-2
9	9606.ENSP00000233242	0.983	Apolipoprotein B-100
10	9606.ENSP00000354677	0.980	Glutathione peroxidase 7
11	9606.ENSP00000247461	0.978	Calnexin
12	9606.ENSP00000263556	0.978	Prolyl 4-hydroxylase subunit alpha-1
13	9606.ENSP00000346635	0.977	ERO1-like protein beta
14	9606.ENSP00000404833	0.969	Tapasin
15	9606.ENSP00000480150	0.967	Hypoxia up-regulated protein 1
16	9606.ENSP00000316881	0.963	Prolyl 3-hydroxylase 2
17	9606.ENSP00000401749	0.961	Prolyl 4-hydroxylase subunit alpha-3
18	9606.ENSP00000385385	0.953	Protein disulfide-isomerase A6
19	9606.ENSP00000236040	0.951	Prolyl 3-hydroxylase 1
20	9606.ENSP00000323696	0.948	Cartilage-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003756	0.999	protein disulfide isomerase activity
GO:0044877	0.998	protein-containing complex binding
GO:0005515	0.998	protein binding
GO:0015035	0.997	protein-disulfide reductase activity
GO:0016705	0.956	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031545	0.946	peptidyl-proline 4-dioxygenase activity
GO:0050839	0.888	cell adhesion molecule binding
GO:0005102	0.749	signaling receptor binding
GO:0005178	0.572	integrin binding
GO:0097159	0.393	organic cyclic compound binding
GO:0046983	0.372	protein dimerization activity
GO:1901363	0.356	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.992	cellular process
GO:0019538	0.992	protein metabolic process
GO:0050896	0.982	response to stimulus
GO:0050794	0.952	regulation of cellular process
GO:0042221	0.942	response to chemical
GO:0051716	0.913	cellular response to stimulus
GO:0010033	0.912	response to organic substance
GO:0006508	0.906	proteolysis
GO:0070887	0.854	cellular response to chemical stimulus
GO:0048518	0.831	positive regulation of biological process
GO:0071310	0.740	cellular response to organic substance
GO:0051641	0.735	cellular localization
GO:0036211	0.712	protein modification process
GO:0051604	0.659	protein maturation
GO:0016485	0.632	protein processing
GO:0048522	0.622	positive regulation of cellular process
GO:0006950	0.581	response to stress
GO:0140448	0.548	signaling receptor ligand precursor processing
GO:0065008	0.532	regulation of biological quality
GO:0018208	0.468	peptidyl-proline modification
GO:0048583	0.458	regulation of response to stimulus
GO:0034097	0.438	response to cytokine
GO:0006810	0.436	transport
GO:0048519	0.427	negative regulation of biological process
GO:0044237	0.422	cellular metabolic process
GO:0043903	0.411	regulation of biological process involved in symbiotic interaction
GO:0071345	0.407	cellular response to cytokine stimulus
GO:0032501	0.371	multicellular organismal process
GO:0006457	0.363	protein folding
GO:0033554	0.361	cellular response to stress
GO:0043603	0.359	amide metabolic process
GO:0048523	0.359	negative regulation of cellular process
GO:0009966	0.340	regulation of signal transduction
GO:0042981	0.308	regulation of apoptotic process
GO:0048856	0.303	anatomical structure development
GO:0019222	0.300	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0070013	0.952	intracellular organelle lumen
GO:0016020	0.856	membrane
GO:0032991	0.356	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	0.999	Acting on a sulfur group of donors.
EC:5.3.4.1	0.999	protein disulfide-isomerase.
EC:1.14.-.-	0.956	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
EC:1.14.11.-	0.952	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]