StarFunc result for job id P07288

User Input

>input (261 residues)
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD
LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
SLYTKVVHYRKWIKDTIVANP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07288	1.000	1.000	3.491E-54	261	1.000	1.000	P07288.pdb.gz	KLK3_HUMAN Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2
2	AFDB:P20151	0.957	0.957	3.449E-47	261	0.770	0.770	P20151.pdb.gz	KLK2_HUMAN Kallikrein-2 OS=Homo sapiens OX=9606 GN=KLK2 PE=1 SV=1
3	AFDB:P06870	0.941	0.938	5.450E-41	262	0.605	0.603	P06870.pdb.gz	KLK1_HUMAN Kallikrein-1 OS=Homo sapiens OX=9606 GN=KLK1 PE=1 SV=2
4	PDB:4nffA	0.870	0.991	5.755E-41	229	0.705	0.803	4nffA.pdb.gz	Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
5	AFDB:P00755	0.965	0.965	3.048E-40	261	0.556	0.556	P00755.pdb.gz	K1KB1_MOUSE Kallikrein 1-related peptidase b1 OS=Mus musculus OX=10090 GN=Klk1b1 PE=2 SV=1
6	AFDB:Q61759	0.960	0.960	1.292E-39	261	0.563	0.563	Q61759.pdb.gz	K1B21_MOUSE Kallikrein 1-related peptidase b21 OS=Mus musculus OX=10090 GN=Klk1b21 PE=2 SV=3
7	AFDB:A0A0G2K6G1	0.955	0.955	3.923E-39	261	0.544	0.544	A0A0G2K6G1.pdb.gz	A0A0G2K6G1_RAT Kallikrein 1 OS=Rattus norvegicus OX=10116 GN=Klk1 PE=4 SV=2
8	AFDB:P36368	0.966	0.966	4.383E-39	261	0.521	0.521	P36368.pdb.gz	EGFB2_MOUSE Epidermal growth factor-binding protein type B OS=Mus musculus OX=10090 GN=Egfbp2 PE=1 SV=1
9	PDB:3qumP	0.831	0.911	5.469E-39	237	0.908	1.000	3qumP.pdb.gz	Crystal structure of human prostate-specific antigen in a sandwich antibody complex.
10	AFDB:G3V8H1	0.931	0.931	6.835E-39	261	0.544	0.544	G3V8H1.pdb.gz	G3V8H1_RAT Kallikrein 1 OS=Rattus norvegicus OX=10116 GN=Klk1 PE=4 SV=1
11	AFDB:P15945	0.966	0.966	1.066E-38	261	0.533	0.533	P15945.pdb.gz	K1KB5_MOUSE Kallikrein 1-related peptidase b5 OS=Mus musculus OX=10090 GN=Klk1b5 PE=2 SV=1
12	AFDB:P36376	0.936	0.943	1.191E-38	259	0.556	0.560	P36376.pdb.gz	KLK12_RAT Glandular kallikrein-12, submandibular/renal OS=Rattus norvegicus OX=10116 GN=Klk12 PE=2 SV=1
13	PDB:1spjA	0.888	0.981	2.680E-35	236	0.559	0.619	1spjA.pdb.gz	1.70 A X-ray structure of human apo kallikrein 1: Structural changes upon peptide inhibitor/substrate binding
14	PDB:1ao5A	0.889	0.982	3.180E-33	236	0.479	0.530	1ao5A.pdb.gz
15	PDB:1tonA	0.819	0.939	8.680E-31	227	0.479	0.551	1tonA.pdb.gz	Rat submaxillary gland serine protease, tonin. Structure solution and refinement at 1.8 A resolution.
16	PDB:5ms3A	0.847	0.967	7.802E-29	228	0.379	0.434	5ms3A.pdb.gz	Specificity profiles and antagonistic Ca2+ and Zn2+ regulation of human KLK8/neuropsin activity by modules identified in crystal structures
17	PDB:1npmA	0.817	0.953	1.897E-28	223	0.406	0.475	1npmA.pdb.gz
18	PDB:2ra3A	0.829	0.963	2.241E-28	224	0.379	0.442	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
19	PDB:2a31A	0.827	0.965	8.499E-28	223	0.364	0.426	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
20	PDB:2qxgA	0.831	0.965	3.807E-27	224	0.372	0.433	2qxgA.pdb.gz	Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07288	0.0	536	261	1.000	1.000	KLK3_HUMAN Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2
2	P20151	3.63e-149	419	261	0.770	0.770	KLK2_HUMAN Kallikrein-2 OS=Homo sapiens OX=9606 GN=KLK2 PE=1 SV=1
3	P06870	5.50e-113	327	262	0.605	0.603	KLK1_HUMAN Kallikrein-1 OS=Homo sapiens OX=9606 GN=KLK1 PE=1 SV=2
4	Q61759	7.56e-105	306	261	0.559	0.559	K1B21_MOUSE Kallikrein 1-related peptidase b21 OS=Mus musculus OX=10090 GN=Klk1b21 PE=2 SV=3
5	P00755	2.49e-104	305	261	0.556	0.556	K1KB1_MOUSE Kallikrein 1-related peptidase b1 OS=Mus musculus OX=10090 GN=Klk1b1 PE=2 SV=1
6	P36376	5.76e-104	304	259	0.556	0.560	KLK12_RAT Glandular kallikrein-12, submandibular/renal OS=Rattus norvegicus OX=10116 GN=Klk12 PE=2 SV=1
7	G3V8H1	1.30e-103	303	261	0.544	0.544	G3V8H1_RAT Kallikrein 1 OS=Rattus norvegicus OX=10116 GN=Klk1 PE=4 SV=1
8	P15948	2.38e-100	295	259	0.556	0.560	K1B22_MOUSE Kallikrein 1-related peptidase b22 OS=Mus musculus OX=10090 GN=Klk1b22 PE=1 SV=1
9	P15945	8.59e-99	291	261	0.533	0.533	K1KB5_MOUSE Kallikrein 1-related peptidase b5 OS=Mus musculus OX=10090 GN=Klk1b5 PE=2 SV=1
10	P15949	1.50e-98	290	261	0.533	0.533	K1KB9_MOUSE Kallikrein 1-related peptidase b9 OS=Mus musculus OX=10090 GN=Klk1b9 PE=2 SV=1
11	P00759	2.96e-96	285	259	0.529	0.533	KLK2_RAT Tonin OS=Rattus norvegicus OX=10116 GN=Klk2 PE=1 SV=1
12	P36369	1.44e-95	283	261	0.529	0.529	K1B26_MOUSE Kallikrein 1-related peptidase b26 OS=Mus musculus OX=10090 GN=Klk1b26 PE=2 SV=1
13	P36368	3.17e-95	282	261	0.521	0.521	EGFB2_MOUSE Epidermal growth factor-binding protein type B OS=Mus musculus OX=10090 GN=Egfbp2 PE=1 SV=1
14	Q9JM71	2.70e-93	277	263	0.544	0.540	K1B27_MOUSE Kallikrein 1-related peptidase b27 OS=Mus musculus OX=10090 GN=Klk1b27 PE=1 SV=1
15	P00757	1.12e-90	270	256	0.506	0.516	K1KB4_MOUSE Kallikrein 1-related peptidase-like b4 OS=Mus musculus OX=10090 GN=Klk1b4 PE=1 SV=1
16	P07647	5.98e-89	266	259	0.490	0.494	KLK9_RAT Submandibular glandular kallikrein-9 OS=Rattus norvegicus OX=10116 GN=Klk9 PE=1 SV=1
17	A0A0G2K6G1	1.73e-76	234	250	0.425	0.444	A0A0G2K6G1_RAT Kallikrein 1 OS=Rattus norvegicus OX=10116 GN=Klk1 PE=4 SV=2
18	Q61955	2.20e-70	219	260	0.429	0.431	KLK8_MOUSE Kallikrein-8 OS=Mus musculus OX=10090 GN=Klk8 PE=1 SV=1
19	Q9UKR3	2.61e-70	219	277	0.421	0.397	KLK13_HUMAN Kallikrein-13 OS=Homo sapiens OX=9606 GN=KLK13 PE=2 SV=1
20	Q8CGR6	3.94e-70	219	276	0.410	0.388	Q8CGR6_MOUSE Glandular kallikrein KLK13 OS=Mus musculus OX=10090 GN=Klk13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08517 AXH	3.2e+02	13.3	Ataxin-1 and HBP1 module (AXH)
2	PF09342 DUF1986	4.9	19.0	Domain of unknown function (DUF1986)
3	PF00089 Trypsin	2.5e-65	232.0	Trypsin
4	PF13365 Trypsin_2	6.4e-06	38.7	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314151

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363822	0.998	Androgen receptor
2	9606.ENSP00000376793	0.993	Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3
3	9606.ENSP00000323929	0.990	Alpha-2-macroglobulin
4	9606.ENSP00000333203	0.978	Plasma serine protease inhibitor
5	9606.ENSP00000416066	0.972	Alpha-1-antitrypsin
6	9606.ENSP00000370473	0.965	Insulin-like growth factor-binding protein 3
7	9606.ENSP00000302665	0.958	Insulin-like growth factor I
8	9606.ENSP00000391826	0.936	Insulin-like growth factor II
9	9606.ENSP00000296417	0.914	Histone H2A.Z
10	9606.ENSP00000313581	0.913	Kallikrein-2
11	9606.ENSP00000358151	0.911	Histone H2B type 2-E
12	9606.ENSP00000332194	0.908	Histone H2A type 2-C
13	9606.ENSP00000434024	0.908	Histone H2AX
14	9606.ENSP00000308405	0.903	Histone H2A.V
15	9606.ENSP00000416683	0.903	Insulin-like growth factor-binding protein complex acid labile subunit
16	9606.ENSP00000343325	0.901	Serine/threonine-protein kinase N1
17	9606.ENSP00000366618	0.901	Histone H2B type 1-L
18	9606.ENSP00000274764	0.900	Histone H2B type 1-A
19	9606.ENSP00000289316	0.900	Histone H2B type 1-D
20	9606.ENSP00000328484	0.900	Histone H2A type 1-J

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004252	0.996	serine-type endopeptidase activity
GO:0005515	0.975	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.984	biological regulation
GO:0019222	0.970	regulation of metabolic process
GO:0048518	0.966	positive regulation of biological process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0071704	0.950	organic substance metabolic process
GO:0044238	0.946	primary metabolic process
GO:0006807	0.939	nitrogen compound metabolic process
GO:0010468	0.928	regulation of gene expression
GO:0043170	0.916	macromolecule metabolic process
GO:0010604	0.915	positive regulation of macromolecule metabolic process
GO:0019538	0.907	protein metabolic process
GO:0002697	0.879	regulation of immune effector process
GO:0002684	0.860	positive regulation of immune system process
GO:0002700	0.857	regulation of production of molecular mediator of immune response
GO:0048583	0.845	regulation of response to stimulus
GO:0050794	0.806	regulation of cellular process
GO:0048584	0.801	positive regulation of response to stimulus
GO:0002759	0.798	regulation of antimicrobial humoral response
GO:0002702	0.781	positive regulation of production of molecular mediator of immune response
GO:0002833	0.744	positive regulation of response to biotic stimulus
GO:0050896	0.740	response to stimulus
GO:0002922	0.696	positive regulation of humoral immune response
GO:1900424	0.695	regulation of defense response to bacterium
GO:1900426	0.693	positive regulation of defense response to bacterium
GO:0002786	0.693	regulation of antibacterial peptide production
GO:0002760	0.693	positive regulation of antimicrobial humoral response
GO:0002225	0.671	positive regulation of antimicrobial peptide production
GO:0009987	0.623	cellular process
GO:0048522	0.516	positive regulation of cellular process
GO:0006508	0.492	proteolysis
GO:0048519	0.325	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043227	0.998	membrane-bounded organelle
GO:0005615	0.993	extracellular space
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0070062	0.957	extracellular exosome
GO:0005634	0.948	nucleus
GO:0005737	0.767	cytoplasm
GO:0070013	0.375	intracellular organelle lumen
GO:0032991	0.318	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	0.996	Serine endopeptidases.

[back to server]