StarFunc result for job id P07305

User Input

>input (194 residues)
MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKV
GENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATP
KKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVK
PKAKSSAKRAGKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07305	0.999	0.999	7.622E-26	194	1.000	1.000	P07305.pdb.gz	H10_HUMAN Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3
2	AFDB:P02259	0.545	0.556	1.501E-18	190	0.675	0.689	P02259.pdb.gz	H5_CHICK Histone H5 OS=Gallus gallus OX=9031 PE=1 SV=2
3	PDB:6labV	0.323	0.534	3.970E-11	109	0.562	1.000	6labV.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
4	AFDB:P10771	0.436	0.408	4.277E-10	208	0.376	0.351	P10771.pdb.gz	H24_CAEEL Histone 24 OS=Caenorhabditis elegans OX=6239 GN=his-24 PE=1 SV=4
5	AFDB:P43277	0.340	0.300	9.660E-9	221	0.433	0.380	P43277.pdb.gz	H13_MOUSE Histone H1.3 OS=Mus musculus OX=10090 GN=H1-3 PE=1 SV=2
6	AFDB:Q18336	0.388	0.326	1.029E-8	232	0.314	0.263	Q18336.pdb.gz	H1X_CAEEL Histone H1.X OS=Caenorhabditis elegans OX=6239 GN=hil-1 PE=2 SV=1
7	AFDB:P43275	0.381	0.350	1.825E-8	213	0.448	0.408	P43275.pdb.gz	H11_MOUSE Histone H1.1 OS=Mus musculus OX=10090 GN=H1-1 PE=1 SV=2
8	AFDB:P02253	0.343	0.313	1.945E-8	213	0.433	0.394	P02253.pdb.gz	H12_BOVIN Histone H1.2 OS=Bos taurus OX=9913 GN=H1-2 PE=1 SV=2
9	AFDB:P06350	0.370	0.349	3.236E-8	207	0.412	0.386	P06350.pdb.gz	H1_ONCMY Histone H1 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
10	AFDB:A5PK20	0.390	0.362	5.736E-8	210	0.397	0.367	A5PK20.pdb.gz	A5PK20_BOVIN H1.12 linker histone, cluster member OS=Bos taurus OX=9913 GN=H1-12 PE=2 SV=1
11	AFDB:P16401	0.401	0.351	6.943E-8	226	0.448	0.385	P16401.pdb.gz	H15_HUMAN Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3
12	PDB:7k5yU	0.352	0.859	1.266E-6	75	0.175	0.453	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
13	PDB:7kbfK	0.363	0.870	9.579E-5	78	0.103	0.256	7kbfK.pdb.gz	Structural features of nucleosomes in interphase and metaphase chromosomes.
14	PDB:6l9zS	0.346	0.753	4.138E-4	84	0.160	0.369	6l9zS.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
15	PDB:2g9wA	0.277	0.434	4.038E-2	119	0.021	0.034	2g9wA.pdb.gz
16	PDB:4etsB	0.304	0.385	6.303E-2	149	0.057	0.074	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
17	PDB:6h1cB	0.294	0.412	6.303E-2	134	0.062	0.090	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
18	PDB:2fe3B	0.296	0.386	8.130E-2	143	0.046	0.063	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
19	PDB:7jppB	0.277	0.182	8.130E-2	307	0.052	0.033	7jppB.pdb.gz	The dynamic nature of the human Origin Recognition Complex revealed through five cryoEM structures.
20	PDB:2o03A	0.286	0.411	1.269E-1	129	0.031	0.047	2o03A.pdb.gz	Crystal structure and function of the zinc uptake regulator FurB from Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07305	7.27e-126	354	194	1.000	1.000	H10_HUMAN Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3
2	P10922	6.76e-77	230	194	0.948	0.948	H10_MOUSE Histone H1.0 OS=Mus musculus OX=10090 GN=H1-0 PE=2 SV=4
3	P02259	3.59e-58	182	190	0.670	0.684	H5_CHICK Histone H5 OS=Gallus gallus OX=9031 PE=1 SV=2
4	Q18336	2.22e-18	81.6	232	0.294	0.246	H1X_CAEEL Histone H1.X OS=Caenorhabditis elegans OX=6239 GN=hil-1 PE=2 SV=1
5	A5PK20	4.19e-11	61.6	210	0.206	0.190	A5PK20_BOVIN H1.12 linker histone, cluster member OS=Bos taurus OX=9913 GN=H1-12 PE=2 SV=1
6	Q07133	7.05e-11	60.8	208	0.289	0.269	H1T_MOUSE Histone H1t OS=Mus musculus OX=10090 GN=H1-6 PE=1 SV=4
7	P54671	1.02e-10	60.1	180	0.175	0.189	H1_DICDI Histone H1 OS=Dictyostelium discoideum OX=44689 GN=H1 PE=1 SV=3
8	P10771	1.03e-10	60.5	208	0.160	0.149	H24_CAEEL Histone 24 OS=Caenorhabditis elegans OX=6239 GN=his-24 PE=1 SV=4
9	P43274	2.17e-10	59.7	219	0.191	0.169	H14_MOUSE Histone H1.4 OS=Mus musculus OX=10090 GN=H1-4 PE=1 SV=2
10	P43276	2.97e-10	59.7	223	0.175	0.152	H15_MOUSE Histone H1.5 OS=Mus musculus OX=10090 GN=H1-5 PE=1 SV=2
11	P02255	3.21e-10	59.7	256	0.186	0.141	H1_DROME Histone H1 OS=Drosophila melanogaster OX=7227 GN=His1 PE=1 SV=1
12	P22492	3.75e-10	58.9	207	0.232	0.217	H1T_HUMAN Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4
13	P15865	1.90e-09	57.4	219	0.186	0.164	H14_RAT Histone H1.4 OS=Rattus norvegicus OX=10116 GN=H1-4 PE=1 SV=3
14	P06350	2.40e-09	56.6	207	0.165	0.155	H1_ONCMY Histone H1 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
15	P10412	2.53e-09	57.0	219	0.191	0.169	H14_HUMAN Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2
16	P16402	6.25e-09	55.8	221	0.170	0.149	H13_HUMAN Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2
17	P06349	6.65e-09	55.5	208	0.170	0.159	H1T_RAT Histone H1t OS=Rattus norvegicus OX=10116 GN=H1-6 PE=1 SV=2
18	Q02539	9.37e-09	55.1	215	0.175	0.158	H11_HUMAN Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3
19	P16403	1.43e-08	54.7	213	0.170	0.155	H12_HUMAN Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2
20	P15864	6.64e-08	52.8	212	0.170	0.156	H12_MOUSE Histone H1.2 OS=Mus musculus OX=10090 GN=H1-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	5.7	18.5	Forkhead domain
2	PF00538 Linker_histone	6e-24	95.5	linker histone H1 and H5 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344504

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329662	0.996	Histone H1x
2	9606.ENSP00000266970	0.986	Cyclin-dependent kinase 2
3	9606.ENSP00000344547	0.978	Prothymosin alpha
4	9606.ENSP00000255120	0.977	Nuclear autoantigenic sperm protein
5	9606.ENSP00000361021	0.976	Phosphatase and tensin homolog
6	9606.ENSP00000339524	0.971	DNA fragmentation factor subunit beta
7	9606.ENSP00000269305	0.966	Cellular tumor antigen p53
8	9606.ENSP00000319799	0.961	Histone H1oo
9	9606.ENSP00000244537	0.956	Histone cluster 1 H4 family member f
10	9606.ENSP00000261366	0.951	Lamin-B1
11	9606.ENSP00000358151	0.947	Histone H2B type 2-E
12	9606.ENSP00000475814	0.947	Histone H2A type 2-A
13	9606.ENSP00000369042	0.945	Importin-7
14	9606.ENSP00000345347	0.943	High mobility group protein B1
15	9606.ENSP00000347168	0.942	Histone cluster 1 H4 family member j
16	9606.ENSP00000366956	0.942	Histone cluster 1 H4 family member h
17	9606.ENSP00000366974	0.942	Histone cluster 1 H4 family member b
18	9606.ENSP00000367034	0.942	Histone cluster 1 H4 family member c
19	9606.ENSP00000443017	0.942	Histone cluster 4, H4
20	9606.ENSP00000462355	0.942	Histone cluster 2 H4 family member b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0031490	1.000	chromatin DNA binding
GO:0003723	0.997	RNA binding
GO:0000217	0.731	DNA secondary structure binding
GO:0003680	0.684	minor groove of adenine-thymine-rich DNA binding
GO:0003690	0.549	double-stranded DNA binding
GO:0043565	0.546	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0016043	0.988	cellular component organization
GO:0050789	0.987	regulation of biological process
GO:0065009	0.981	regulation of molecular function
GO:0006325	0.980	chromatin organization
GO:0048519	0.968	negative regulation of biological process
GO:0006338	0.957	chromatin remodeling
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0010468	0.934	regulation of gene expression
GO:0051101	0.930	regulation of DNA binding
GO:0010605	0.905	negative regulation of macromolecule metabolic process
GO:0031507	0.902	heterochromatin formation
GO:0044093	0.896	positive regulation of molecular function
GO:2000677	0.889	regulation of transcription regulatory region DNA binding
GO:0051099	0.803	positive regulation of binding
GO:0043388	0.781	positive regulation of DNA binding
GO:0050794	0.437	regulation of cellular process
GO:0019219	0.348	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.311	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0031981	0.989	nuclear lumen
GO:0005654	0.981	nucleoplasm
GO:0032991	0.975	protein-containing complex
GO:0005694	0.918	chromosome
GO:0000785	0.852	chromatin
GO:0005737	0.695	cytoplasm
GO:0012505	0.463	endomembrane system
GO:0000791	0.394	euchromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]