StarFunc result for job id P07332

User Input

>input (822 residues)
MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
RAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQW
QQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLF
AHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDE
VVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE
LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVL
QEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR
TPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDF
LVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKK
SGVVLHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL
KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTL
LQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLP
CPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A584	0.964	0.964	0.000	822	0.914	0.914	D4A584.pdb.gz	D4A584_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Fes PE=3 SV=1
2	AFDB:A0A2R8QR19	0.477	0.458	8.096E-80	862	0.527	0.502	A0A2R8QR19.pdb.gz
3	AFDB:P09760	0.456	0.455	2.557E-78	823	0.511	0.510	P09760.pdb.gz	FER_RAT Tyrosine-protein kinase Fer OS=Rattus norvegicus OX=10116 GN=Fer PE=1 SV=2
4	AFDB:A2CES6	0.447	0.437	2.356E-73	842	0.504	0.492	A2CES6.pdb.gz
5	AFDB:P18106	0.450	0.284	6.285E-56	1325	0.388	0.241	P18106.pdb.gz	FER_DROME Tyrosine-protein kinase Fer OS=Drosophila melanogaster OX=7227 GN=FER PE=1 SV=3
6	AFDB:B2GV16	0.469	0.784	4.638E-46	481	0.448	0.765	B2GV16.pdb.gz	B2GV16_RAT Fes protein OS=Rattus norvegicus OX=10116 GN=Fes PE=2 SV=1
7	AFDB:E9PT20	0.313	0.226	8.540E-32	1143	0.185	0.133	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
8	AFDB:Q22146	0.417	0.851	1.300E-31	390	0.158	0.333	Q22146.pdb.gz	FRK1_CAEEL Fer-related kinase 1 OS=Caenorhabditis elegans OX=6239 GN=frk-1 PE=1 SV=1
9	AFDB:A0A024R8E2	0.314	0.229	9.663E-31	1130	0.170	0.124	A0A024R8E2.pdb.gz
10	AFDB:P42681	0.317	0.492	1.112E-30	527	0.181	0.283	P42681.pdb.gz	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
11	PDB:1k9aB	0.301	0.548	2.586E-26	441	0.164	0.306	1k9aB.pdb.gz
12	PDB:2h8hA	0.289	0.522	2.077E-24	445	0.172	0.317	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.293	0.429	3.312E-24	555	0.153	0.227	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.290	0.428	1.015E-23	551	0.147	0.220	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:6s73A	0.287	0.831	1.763E-14	269	0.077	0.234	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:5ufuA	0.284	0.607	2.226E-14	369	0.084	0.187	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:2qkwB	0.274	0.719	2.811E-14	292	0.086	0.243	2qkwB.pdb.gz
18	PDB:6b1uA	0.282	0.507	2.945E-14	442	0.086	0.161	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
19	PDB:8dksA	0.261	0.714	4.083E-14	283	0.085	0.247	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
20	PDB:4rerA	0.282	0.491	4.921E-14	459	0.090	0.161	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZWJ2	0.0	1408	781	0.861	0.907	A0A8I5ZWJ2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Fes PE=3 SV=1
2	B2GV16	0.0	677	481	0.440	0.753	B2GV16_RAT Fes protein OS=Rattus norvegicus OX=10116 GN=Fes PE=2 SV=1
3	D4A584	0.0	1500	822	0.915	0.915	D4A584_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Fes PE=3 SV=1
4	P07332	0.0	1680	822	1.000	1.000	FES_HUMAN Tyrosine-protein kinase Fes/Fps OS=Homo sapiens OX=9606 GN=FES PE=1 SV=3
5	P09760	0.0	817	823	0.513	0.513	FER_RAT Tyrosine-protein kinase Fer OS=Rattus norvegicus OX=10116 GN=Fer PE=1 SV=2
6	P16591	0.0	827	822	0.511	0.511	FER_HUMAN Tyrosine-protein kinase Fer OS=Homo sapiens OX=9606 GN=FER PE=1 SV=2
7	P16879	0.0	1476	822	0.906	0.906	FES_MOUSE Tyrosine-protein kinase Fes/Fps OS=Mus musculus OX=10090 GN=Fes PE=1 SV=2
8	P70451	0.0	813	823	0.509	0.508	FER_MOUSE Tyrosine-protein kinase Fer OS=Mus musculus OX=10090 GN=Fer PE=1 SV=2
9	W0S0X4	0.0	827	822	0.511	0.511	W0S0X4_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=Pe1Fe3 PE=2 SV=1
10	U6DU97	8.65e-132	392	198	0.229	0.949	U6DU97_NEOVI Tyrosine-protein kinase (Fragment) OS=Neovison vison OX=452646 GN=FES PE=2 SV=1
11	P18106	2.60e-128	417	1325	0.241	0.149	FER_DROME Tyrosine-protein kinase Fer OS=Drosophila melanogaster OX=7227 GN=FER PE=1 SV=3
12	F7BN18	4.19e-77	273	1128	0.182	0.133	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
13	P03949	6.58e-76	270	1224	0.178	0.119	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
14	E9PT20	8.80e-76	270	1143	0.181	0.130	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
15	Q2PYT4	9.15e-76	270	1143	0.181	0.130	Q2PYT4_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
16	P00520	1.37e-75	269	1123	0.181	0.133	ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus OX=10090 GN=Abl1 PE=1 SV=3
17	P00519	2.11e-75	268	1130	0.181	0.132	ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4
18	Q4JIM5	1.37e-73	263	1182	0.181	0.126	ABL2_MOUSE Tyrosine-protein kinase ABL2 OS=Mus musculus OX=10090 GN=Abl2 PE=1 SV=1
19	P00528	1.73e-73	252	552	0.196	0.292	SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster OX=7227 GN=Src64B PE=1 SV=3
20	Q22146	2.08e-73	247	390	0.162	0.341	FRK1_CAEEL Fer-related kinase 1 OS=Caenorhabditis elegans OX=6239 GN=frk-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.6	19.4	ABC1 atypical kinase-like domain
2	PF00611 FCH	0.0034	29.0	Fes/CIP4, and EFC/F-BAR homology domain
3	PF00069 Pkinase	1.8e-45	166.9	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	3.5e-91	316.6	Protein tyrosine and serine/threonine kinase
5	PF00017 SH2	6.7e-13	59.9	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331504

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377061	0.949	Plexin-A1
2	9606.ENSP00000356042	0.945	Ezrin
3	9606.ENSP00000391676	0.935	Tyrosine-protein kinase JAK3
4	9606.ENSP00000365016	0.933	Insulin receptor substrate 2
5	9606.ENSP00000428056	0.931	Phosphatidylinositol 3-kinase regulatory subunit alpha
6	9606.ENSP00000343204	0.929	Tyrosine-protein kinase JAK1
7	9606.ENSP00000246792	0.924	Ras-related protein R-Ras
8	9606.ENSP00000379111	0.924	Interleukin-4 receptor subunit alpha
9	9606.ENSP00000263923	0.921	Vascular endothelial growth factor receptor 2
10	9606.ENSP00000363318	0.916	Cytokine receptor common subunit gamma
11	9606.ENSP00000369375	0.916	Angiopoietin-1 receptor
12	9606.ENSP00000478570	0.911	Vascular endothelial growth factor A
13	9606.ENSP00000263967	0.910	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
14	9606.ENSP00000231449	0.908	Interleukin-4
15	9606.ENSP00000314897	0.903	Angiopoietin-2
16	9606.ENSP00000336740	0.903	LIM domain kinase 1
17	9606.ENSP00000428340	0.903	Angiopoietin-1
18	9606.ENSP00000309539	0.868	Dihydropyrimidinase-related protein 2
19	9606.ENSP00000288699	0.859	Dihydropyrimidinase-related protein 5
20	9606.ENSP00000356000	0.845	Plexin-A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0019899	0.765	enzyme binding
GO:0008092	0.746	cytoskeletal protein binding
GO:0042802	0.657	identical protein binding
GO:0015631	0.570	tubulin binding
GO:0004715	0.370	non-membrane spanning protein tyrosine kinase activity
GO:0008289	0.339	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0048856	0.940	anatomical structure development
GO:0050896	0.937	response to stimulus
GO:0032501	0.936	multicellular organismal process
GO:0007275	0.903	multicellular organism development
GO:0048518	0.891	positive regulation of biological process
GO:0051716	0.874	cellular response to stimulus
GO:0007154	0.859	cell communication
GO:0048731	0.842	system development
GO:0023052	0.817	signaling
GO:0048583	0.817	regulation of response to stimulus
GO:0048522	0.804	positive regulation of cellular process
GO:0007165	0.789	signal transduction
GO:0071704	0.703	organic substance metabolic process
GO:0044237	0.679	cellular metabolic process
GO:0044238	0.676	primary metabolic process
GO:0051239	0.652	regulation of multicellular organismal process
GO:0006807	0.642	nitrogen compound metabolic process
GO:0071840	0.607	cellular component organization or biogenesis
GO:0043170	0.595	macromolecule metabolic process
GO:0016043	0.562	cellular component organization
GO:0009888	0.542	tissue development
GO:0008283	0.498	cell population proliferation
GO:0048589	0.495	developmental growth
GO:0048519	0.493	negative regulation of biological process
GO:1901564	0.476	organonitrogen compound metabolic process
GO:0051128	0.472	regulation of cellular component organization
GO:0048523	0.467	negative regulation of cellular process
GO:0019222	0.466	regulation of metabolic process
GO:0002682	0.450	regulation of immune system process
GO:0072359	0.449	circulatory system development
GO:0002684	0.437	positive regulation of immune system process
GO:0042221	0.429	response to chemical
GO:0016310	0.417	phosphorylation
GO:0019538	0.412	protein metabolic process
GO:0048513	0.402	animal organ development
GO:0060255	0.402	regulation of macromolecule metabolic process
GO:0033002	0.400	muscle cell proliferation
GO:0031323	0.399	regulation of cellular metabolic process
GO:0014855	0.380	striated muscle cell proliferation
GO:0035265	0.372	organ growth
GO:0009893	0.365	positive regulation of metabolic process
GO:0060537	0.360	muscle tissue development
GO:0050776	0.357	regulation of immune response
GO:0007166	0.355	cell surface receptor signaling pathway
GO:0014706	0.352	striated muscle tissue development
GO:0060419	0.348	heart growth
GO:0043412	0.347	macromolecule modification
GO:0051171	0.345	regulation of nitrogen compound metabolic process
GO:0080090	0.344	regulation of primary metabolic process
GO:0036211	0.339	protein modification process
GO:0048584	0.332	positive regulation of response to stimulus
GO:0050865	0.320	regulation of cell activation
GO:0032879	0.315	regulation of localization
GO:0023051	0.311	regulation of signaling
GO:0010646	0.309	regulation of cell communication
GO:0006468	0.307	protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.999	cytosol
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0071944	0.968	cell periphery
GO:0016020	0.968	membrane
GO:0005856	0.966	cytoskeleton
GO:0005886	0.954	plasma membrane
GO:0043227	0.748	membrane-bounded organelle
GO:0043231	0.691	intracellular membrane-bounded organelle
GO:0015630	0.501	microtubule cytoskeleton
GO:0030054	0.435	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.370	non-specific protein-tyrosine kinase.

[back to server]