StarFunc result for job id P07333

User Input

>input (972 residues)
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA
QPLLQPNNYQFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07333	1.000	1.000	0.000	972	1.000	1.000	P07333.pdb.gz	CSF1R_HUMAN Macrophage colony-stimulating factor 1 receptor OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=2
2	AFDB:Q00495	0.421	0.418	0.000	978	0.745	0.740	Q00495.pdb.gz	CSF1R_RAT Macrophage colony-stimulating factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Csf1r PE=1 SV=1
3	AFDB:Q9I8N6	0.344	0.343	4.426E-100	977	0.448	0.445	Q9I8N6.pdb.gz	CSF1R_DANRE Macrophage colony-stimulating factor 1 receptor OS=Danio rerio OX=7955 GN=csf1r PE=2 SV=1
4	AFDB:Q8JFR5	0.349	0.347	4.363E-93	976	0.409	0.408	Q8JFR5.pdb.gz	KITA_DANRE Mast/stem cell growth factor receptor kita OS=Danio rerio OX=7955 GN=kita PE=2 SV=2
5	AFDB:P05532	0.325	0.323	3.331E-92	979	0.397	0.394	P05532.pdb.gz	KIT_MOUSE Mast/stem cell growth factor receptor Kit OS=Mus musculus OX=10090 GN=Kit PE=1 SV=3
6	AFDB:P10721	0.393	0.392	8.078E-92	976	0.397	0.395	P10721.pdb.gz	KIT_HUMAN Mast/stem cell growth factor receptor Kit OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1
7	AFDB:B8A5K6	0.320	0.325	1.038E-90	957	0.386	0.392	B8A5K6.pdb.gz	B8A5K6_DANRE Mast/stem cell growth factor receptor OS=Danio rerio OX=7955 GN=kitb PE=3 SV=1
8	AFDB:F1QPE2	0.319	0.329	1.716E-88	943	0.370	0.382	F1QPE2.pdb.gz
9	AFDB:P16234	0.309	0.277	1.303E-81	1089	0.338	0.302	P16234.pdb.gz	PGFRA_HUMAN Platelet-derived growth factor receptor alpha OS=Homo sapiens OX=9606 GN=PDGFRA PE=1 SV=1
10	AFDB:P05622	0.312	0.278	1.691E-81	1098	0.347	0.307	P05622.pdb.gz	PGFRB_MOUSE Platelet-derived growth factor receptor beta OS=Mus musculus OX=10090 GN=Pdgfrb PE=1 SV=2
11	PDB:1k9aB	0.252	0.545	8.975E-20	441	0.104	0.229	1k9aB.pdb.gz
12	PDB:2h8hA	0.246	0.518	9.455E-20	445	0.116	0.254	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.244	0.415	2.136E-17	555	0.100	0.175	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:1e07A	0.128	0.169	3.076E-17	642	0.086	0.131	1e07A.pdb.gz
15	PDB:4k2rA	0.239	0.413	1.020E-16	551	0.104	0.183	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:5oj2B	0.172	0.222	1.630E-16	692	0.101	0.142	5oj2B.pdb.gz
17	PDB:2rcjC	0.119	0.179	1.100E-13	523	0.076	0.141	2rcjC.pdb.gz
18	PDB:6s73A	0.239	0.791	2.282E-13	269	0.063	0.227	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
19	PDB:7mfdA	0.234	0.515	5.535E-13	410	0.093	0.220	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
20	PDB:6dldD	0.138	0.420	1.274E-12	269	0.040	0.145	6dldD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTL4	0.0	654	970	0.394	0.395	A0A0G2JTL4_RAT Mast/stem cell growth factor receptor OS=Rattus norvegicus OX=10116 GN=Kit PE=1 SV=2
2	B8A5K6	0.0	630	957	0.397	0.403	B8A5K6_DANRE Mast/stem cell growth factor receptor OS=Danio rerio OX=7955 GN=kitb PE=3 SV=1
3	P05532	0.0	663	979	0.403	0.400	KIT_MOUSE Mast/stem cell growth factor receptor Kit OS=Mus musculus OX=10090 GN=Kit PE=1 SV=3
4	P07333	0.0	2026	972	1.000	1.000	CSF1R_HUMAN Macrophage colony-stimulating factor 1 receptor OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=2
5	P09581	0.0	1443	977	0.752	0.748	CSF1R_MOUSE Macrophage colony-stimulating factor 1 receptor OS=Mus musculus OX=10090 GN=Csf1r PE=1 SV=3
6	P10721	0.0	659	976	0.405	0.404	KIT_HUMAN Mast/stem cell growth factor receptor Kit OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1
7	Q00495	0.0	1429	978	0.748	0.743	CSF1R_RAT Macrophage colony-stimulating factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Csf1r PE=1 SV=1
8	Q63116	0.0	655	978	0.394	0.392	Q63116_RAT Mast/stem cell growth factor receptor OS=Rattus norvegicus OX=10116 GN=Kit PE=1 SV=1
9	Q8JFR5	0.0	685	976	0.428	0.426	KITA_DANRE Mast/stem cell growth factor receptor kita OS=Danio rerio OX=7955 GN=kita PE=2 SV=2
10	Q9I8N6	0.0	776	977	0.449	0.446	CSF1R_DANRE Macrophage colony-stimulating factor 1 receptor OS=Danio rerio OX=7955 GN=csf1r PE=2 SV=1
11	P20786	1.80e-159	499	1088	0.341	0.304	PGFRA_RAT Platelet-derived growth factor receptor alpha OS=Rattus norvegicus OX=10116 GN=Pdgfra PE=1 SV=2
12	P26618	4.71e-159	498	1089	0.345	0.308	PGFRA_MOUSE Platelet-derived growth factor receptor alpha OS=Mus musculus OX=10090 GN=Pdgfra PE=1 SV=3
13	Q05030	1.90e-156	492	1097	0.355	0.314	PGFRB_RAT Platelet-derived growth factor receptor beta OS=Rattus norvegicus OX=10116 GN=Pdgfrb PE=2 SV=2
14	P05622	1.23e-155	489	1098	0.354	0.313	PGFRB_MOUSE Platelet-derived growth factor receptor beta OS=Mus musculus OX=10090 GN=Pdgfrb PE=1 SV=2
15	P16234	1.79e-154	486	1089	0.337	0.301	PGFRA_HUMAN Platelet-derived growth factor receptor alpha OS=Homo sapiens OX=9606 GN=PDGFRA PE=1 SV=1
16	P09619	1.48e-153	484	1106	0.352	0.309	PGFRB_HUMAN Platelet-derived growth factor receptor beta OS=Homo sapiens OX=9606 GN=PDGFRB PE=1 SV=1
17	Q9PUF6	1.61e-152	481	1087	0.334	0.299	PGFRA_CHICK Platelet-derived growth factor receptor alpha OS=Gallus gallus OX=9031 GN=PDGFRA PE=2 SV=1
18	Q9DE49	3.34e-147	466	1059	0.323	0.297	PGFRA_DANRE Platelet-derived growth factor receptor alpha OS=Danio rerio OX=7955 GN=pdgfra PE=2 SV=1
19	P36888	9.23e-144	455	993	0.288	0.282	FLT3_HUMAN Receptor-type tyrosine-protein kinase FLT3 OS=Homo sapiens OX=9606 GN=FLT3 PE=1 SV=2
20	D9MNA7	5.59e-143	455	1064	0.318	0.290	D9MNA7_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=pdgfrb2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	20	16.6	CD80-like C2-set immunoglobulin domain
2	PF19462 DUF5999	63	15.0	Family of unknown function (DUF5999)
3	PF07679 I-set	4.4e-14	63.6	Immunoglobulin I-set domain
4	PF00047 ig	8.8e-20	82.0	Immunoglobulin domain
5	PF13895 Ig_2	2.5e-14	64.7	Immunoglobulin domain
6	PF13927 Ig_3	5.1e-27	105.6	Immunoglobulin domain
7	PF16706 Izumo-Ig	0.53	21.6	Izumo-like Immunoglobulin domain
8	PF00069 Pkinase	1.3e-36	137.9	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	1.1e-101	351.0	Protein tyrosine and serine/threonine kinase
10	PF07686 V-set	0.14	23.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286301

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327513	0.999	Macrophage colony-stimulating factor 1
2	9606.ENSP00000397863	0.999	Interleukin-34
3	9606.ENSP00000376345	0.997	Growth factor receptor-bound protein 2
4	9606.ENSP00000262629	0.995	TYRO protein tyrosine kinase-binding protein
5	9606.ENSP00000264033	0.992	E3 ubiquitin-protein ligase CBL
6	9606.ENSP00000227163	0.983	Transcription factor PU.1
7	9606.ENSP00000381775	0.977	Tumor necrosis factor ligand superfamily member 11
8	9606.ENSP00000428056	0.955	Phosphatidylinositol 3-kinase regulatory subunit alpha
9	9606.ENSP00000407586	0.953	GTPase HRas
10	9606.ENSP00000468927	0.951	Signal transducing adaptor family member 2
11	9606.ENSP00000046794	0.948	Lymphocyte cytosolic protein 2
12	9606.ENSP00000261023	0.943	Integrin alpha-V
13	9606.ENSP00000452786	0.940	Integrin beta-3
14	9606.ENSP00000359073	0.933	Guanine nucleotide exchange factor VAV3
15	9606.ENSP00000313967	0.927	Complement C1q subcomponent subunit B
16	9606.ENSP00000441691	0.925	Integrin alpha-M
17	9606.ENSP00000478570	0.922	Vascular endothelial growth factor A
18	9606.ENSP00000352071	0.917	Scavenger receptor cysteine-rich type 1 protein M130
19	9606.ENSP00000311857	0.915	Tyrosine-protein phosphatase non-receptor type 2
20	9606.ENSP00000300305	0.914	Runt-related transcription factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004714	0.999	transmembrane receptor protein tyrosine kinase activity
GO:0019955	0.992	cytokine binding
GO:0042802	0.532	identical protein binding
GO:0005102	0.347	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0007165	0.981	signal transduction
GO:0048518	0.979	positive regulation of biological process
GO:0042127	0.968	regulation of cell population proliferation
GO:0007166	0.958	cell surface receptor signaling pathway
GO:0048522	0.933	positive regulation of cellular process
GO:0042221	0.928	response to chemical
GO:0048856	0.925	anatomical structure development
GO:0032501	0.911	multicellular organismal process
GO:0048583	0.910	regulation of response to stimulus
GO:0019222	0.907	regulation of metabolic process
GO:0051239	0.902	regulation of multicellular organismal process
GO:0048584	0.902	positive regulation of response to stimulus
GO:0008284	0.872	positive regulation of cell population proliferation
GO:0008152	0.865	metabolic process
GO:0071704	0.864	organic substance metabolic process
GO:0045937	0.857	positive regulation of phosphate metabolic process
GO:0040012	0.849	regulation of locomotion
GO:0042325	0.839	regulation of phosphorylation
GO:0050793	0.838	regulation of developmental process
GO:0080090	0.816	regulation of primary metabolic process
GO:0060255	0.816	regulation of macromolecule metabolic process
GO:0002682	0.810	regulation of immune system process
GO:0010604	0.807	positive regulation of macromolecule metabolic process
GO:0048468	0.803	cell development
GO:0031401	0.797	positive regulation of protein modification process
GO:0023051	0.756	regulation of signaling
GO:0044237	0.747	cellular metabolic process
GO:0044238	0.740	primary metabolic process
GO:0065009	0.727	regulation of molecular function
GO:0001932	0.699	regulation of protein phosphorylation
GO:0010646	0.663	regulation of cell communication
GO:0070887	0.657	cellular response to chemical stimulus
GO:0007275	0.643	multicellular organism development
GO:0006807	0.630	nitrogen compound metabolic process
GO:0010468	0.624	regulation of gene expression
GO:0048513	0.614	animal organ development
GO:0030334	0.608	regulation of cell migration
GO:0043170	0.604	macromolecule metabolic process
GO:0030097	0.600	hemopoiesis
GO:0042327	0.599	positive regulation of phosphorylation
GO:0018108	0.594	peptidyl-tyrosine phosphorylation
GO:0006950	0.557	response to stress
GO:0050790	0.553	regulation of catalytic activity
GO:0044093	0.550	positive regulation of molecular function
GO:0009966	0.548	regulation of signal transduction
GO:0048519	0.541	negative regulation of biological process
GO:0002376	0.538	immune system process
GO:0051240	0.529	positive regulation of multicellular organismal process
GO:0032101	0.519	regulation of response to external stimulus
GO:0030335	0.516	positive regulation of cell migration
GO:0001934	0.509	positive regulation of protein phosphorylation
GO:0048731	0.495	system development
GO:0010033	0.480	response to organic substance
GO:0043085	0.475	positive regulation of catalytic activity
GO:0048523	0.450	negative regulation of cellular process
GO:0002684	0.438	positive regulation of immune system process
GO:0051338	0.376	regulation of transferase activity
GO:0009653	0.371	anatomical structure morphogenesis
GO:0001817	0.345	regulation of cytokine production
GO:0048870	0.342	cell motility
GO:0010628	0.335	positive regulation of gene expression
GO:1902533	0.335	positive regulation of intracellular signal transduction
GO:0050730	0.330	regulation of peptidyl-tyrosine phosphorylation
GO:0032103	0.327	positive regulation of response to external stimulus
GO:0043549	0.327	regulation of kinase activity
GO:0007169	0.326	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0006952	0.318	defense response
GO:0009605	0.315	response to external stimulus
GO:0071310	0.309	cellular response to organic substance
GO:0051347	0.309	positive regulation of transferase activity
GO:0071345	0.304	cellular response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.994	intracellular anatomical structure
GO:0043226	0.950	organelle
GO:0043227	0.937	membrane-bounded organelle
GO:0043231	0.932	intracellular membrane-bounded organelle
GO:0005737	0.876	cytoplasm
GO:0005634	0.585	nucleus
GO:0070013	0.457	intracellular organelle lumen
GO:0005654	0.331	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.999	receptor protein-tyrosine kinase.

[back to server]