StarFunc result for job id P07339

User Input

>input (412 residues)
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07339	1.000	1.000	2.402E-87	412	1.000	1.000	P07339.pdb.gz	CATD_HUMAN Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1
2	AFDB:P18242	0.913	0.918	2.139E-73	410	0.806	0.810	P18242.pdb.gz	CATD_MOUSE Cathepsin D OS=Mus musculus OX=10090 GN=Ctsd PE=1 SV=1
3	AFDB:Q05744	0.894	0.925	5.553E-63	398	0.670	0.693	Q05744.pdb.gz	CATD_CHICK Cathepsin D OS=Gallus gallus OX=9031 GN=CTSD PE=1 SV=1
4	AFDB:Q9DD89	0.863	0.891	2.079E-62	399	0.636	0.657	Q9DD89.pdb.gz
5	AFDB:O93428	0.881	0.916	5.012E-62	396	0.643	0.669	O93428.pdb.gz	CATD_CHIHA Cathepsin D OS=Chionodraco hamatus OX=36188 GN=ctsd PE=1 SV=2
6	AFDB:P00795	0.797	0.949	5.911E-62	345	0.728	0.870	P00795.pdb.gz	CATD_PIG Cathepsin D OS=Sus scrofa OX=9823 GN=CTSD PE=1 SV=2
7	PDB:5ux4B	0.792	0.958	6.644E-60	340	0.714	0.865	5ux4B.pdb.gz	Development of 2-aminooxazoline 3-azaxanthene beta-amyloid cleaving enzyme (BACE) inhibitors with improved selectivity against Cathepsin D.
8	AFDB:Q7K485	0.847	0.890	4.694E-56	392	0.519	0.546	Q7K485.pdb.gz	Q7K485_DROME Cathepsin D OS=Drosophila melanogaster OX=7227 GN=cathD PE=1 SV=1
9	AFDB:O96009	0.836	0.822	4.576E-52	420	0.471	0.462	O96009.pdb.gz	NAPSA_HUMAN Napsin-A OS=Homo sapiens OX=9606 GN=NAPSA PE=1 SV=1
10	AFDB:P14091	0.845	0.878	1.052E-50	396	0.444	0.462	P14091.pdb.gz	CATE_HUMAN Cathepsin E OS=Homo sapiens OX=9606 GN=CTSE PE=1 SV=3
11	AFDB:Q21966	0.837	0.778	3.938E-50	444	0.498	0.462	Q21966.pdb.gz	ASP4_CAEEL Aspartic protease 4 OS=Caenorhabditis elegans OX=6239 GN=asp-4 PE=2 SV=1
12	PDB:1tzsA	0.738	0.939	9.390E-43	322	0.415	0.531	1tzsA.pdb.gz	Crystal structure of an activation intermediate of cathepsin e
13	PDB:4amtA	0.788	0.926	1.107E-42	349	0.396	0.467	4amtA.pdb.gz
14	PDB:5mktA	0.740	0.921	2.207E-38	329	0.388	0.486	5mktA.pdb.gz
15	PDB:2bjuA	0.699	0.868	2.456E-31	329	0.272	0.340	2bjuA.pdb.gz	X-Ray Structure of Plasmepsin II Complexed with a Potent Achiral Inhibitor.
16	PDB:3qvcA	0.691	0.765	3.153E-27	368	0.238	0.266	3qvcA.pdb.gz
17	PDB:2qzwA	0.670	0.801	4.702E-25	341	0.226	0.273	2qzwA.pdb.gz
18	PDB:3aupA	0.526	0.570	9.205E-16	377	0.163	0.178	3aupA.pdb.gz
19	PDB:3v0aB	0.087	0.053	4.475E-2	1150	0.085	0.030	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
20	PDB:2avoA	0.104	0.337	4.039E-1	99	0.041	0.172	2avoA.pdb.gz	Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O93428	0.0	558	396	0.648	0.674	CATD_CHIHA Cathepsin D OS=Chionodraco hamatus OX=36188 GN=ctsd PE=1 SV=2
2	P00795	0.0	595	345	0.728	0.870	CATD_PIG Cathepsin D OS=Sus scrofa OX=9823 GN=CTSD PE=1 SV=2
3	P07339	0.0	847	412	1.000	1.000	CATD_HUMAN Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1
4	P18242	0.0	692	410	0.799	0.802	CATD_MOUSE Cathepsin D OS=Mus musculus OX=10090 GN=Ctsd PE=1 SV=1
5	P24268	0.0	691	407	0.801	0.811	CATD_RAT Cathepsin D OS=Rattus norvegicus OX=10116 GN=Ctsd PE=1 SV=1
6	Q05744	0.0	572	398	0.672	0.696	CATD_CHICK Cathepsin D OS=Gallus gallus OX=9031 GN=CTSD PE=1 SV=1
7	Q8AWD9	0.0	558	398	0.631	0.653	Q8AWD9_DANRE Cathepsin D OS=Danio rerio OX=7955 GN=catD PE=1 SV=1
8	Q7K485	8.95e-150	431	392	0.502	0.528	Q7K485_DROME Cathepsin D OS=Drosophila melanogaster OX=7227 GN=cathD PE=1 SV=1
9	Q21966	8.03e-145	421	444	0.488	0.453	ASP4_CAEEL Aspartic protease 4 OS=Caenorhabditis elegans OX=6239 GN=asp-4 PE=2 SV=1
10	O96009	8.09e-134	392	420	0.451	0.443	NAPSA_HUMAN Napsin-A OS=Homo sapiens OX=9606 GN=NAPSA PE=1 SV=1
11	Q805F3	1.02e-127	375	397	0.454	0.471	CATEA_XENLA Cathepsin E-A OS=Xenopus laevis OX=8355 GN=ctse-a PE=1 SV=1
12	O09043	5.65e-126	372	419	0.442	0.434	NAPSA_MOUSE Napsin-A OS=Mus musculus OX=10090 GN=Napsa PE=1 SV=1
13	P70269	1.06e-123	365	397	0.449	0.466	CATE_MOUSE Cathepsin E OS=Mus musculus OX=10090 GN=Ctse PE=1 SV=2
14	P14091	5.55e-123	363	396	0.454	0.472	CATE_HUMAN Cathepsin E OS=Homo sapiens OX=9606 GN=CTSE PE=1 SV=3
15	P16228	2.58e-120	357	398	0.437	0.452	CATE_RAT Cathepsin E OS=Rattus norvegicus OX=10116 GN=Ctse PE=1 SV=3
16	P00796	7.28e-118	350	401	0.439	0.451	RENI2_MOUSE Renin-2 OS=Mus musculus OX=10090 GN=Ren2 PE=1 SV=1
17	P08424	2.38e-117	349	402	0.439	0.450	RENI_RAT Renin OS=Rattus norvegicus OX=10116 GN=Ren1 PE=1 SV=2
18	P06281	4.10e-117	349	402	0.439	0.450	RENI1_MOUSE Renin-1 OS=Mus musculus OX=10090 GN=Ren1 PE=1 SV=1
19	Q18DC8	7.45e-117	348	395	0.430	0.448	RE123_ECHOC Renin OS=Echis ocellatus OX=99586 GN=Asp-Eoc123 PE=1 SV=1
20	P00797	4.30e-112	336	406	0.413	0.419	RENI_HUMAN Renin OS=Homo sapiens OX=9606 GN=REN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07966 A1_Propeptide	2.3e-05	35.5	A1 Propeptide
2	PF00026 Asp	2.1e-116	400.4	Eukaryotic aspartyl protease
3	PF14541 TAXi_C	0.14	23.4	Xylanase inhibitor C-terminal
4	PF14543 TAXi_N	5.3e-11	54.6	Xylanase inhibitor N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000236671

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345672	0.985	Cathepsin B
2	9606.ENSP00000349437	0.978	Cation-independent mannose-6-phosphate receptor
3	9606.ENSP00000405330	0.961	Estrogen receptor
4	9606.ENSP00000345344	0.939	Cathepsin L1
5	9606.ENSP00000009530	0.938	HLA class II histocompatibility antigen gamma chain
6	9606.ENSP00000355627	0.935	Angiotensinogen
7	9606.ENSP00000273047	0.929	Ras-related protein Rab-5A
8	9606.ENSP00000378394	0.928	Prosaposin
9	9606.ENSP00000339398	0.918	Major histocompatibility complex, class II, DQ alpha 1
10	9606.ENSP00000361066	0.918	Nuclear receptor coactivator 3
11	9606.ENSP00000347665	0.916	Collagen alpha-1(XVIII) chain
12	9606.ENSP00000263253	0.914	Histone acetyltransferase p300
13	9606.ENSP00000053867	0.911	Granulins
14	9606.ENSP00000318822	0.911	BH3-interacting domain death agonist
15	9606.ENSP00000222305	0.910	Upstream stimulatory factor 2
16	9606.ENSP00000353099	0.910	HLA class II histocompatibility antigen, DRB1-15 beta chain
17	9606.ENSP00000329357	0.909	Transcription factor Sp1
18	9606.ENSP00000357000	0.907	Upstream stimulatory factor 1
19	9606.ENSP00000399968	0.907	Nuclear receptor coactivator 2
20	9606.ENSP00000318820	0.905	Thyroid peroxidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004190	1.000	aspartic-type endopeptidase activity
GO:0005515	0.995	protein binding
GO:0008234	0.748	cysteine-type peptidase activity
GO:0004197	0.368	cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.975	primary metabolic process
GO:0019538	0.957	protein metabolic process
GO:0065007	0.909	biological regulation
GO:0050789	0.898	regulation of biological process
GO:0006508	0.886	proteolysis
GO:0009987	0.885	cellular process
GO:0050794	0.760	regulation of cellular process
GO:0019222	0.716	regulation of metabolic process
GO:0019882	0.667	antigen processing and presentation
GO:0048518	0.644	positive regulation of biological process
GO:0060255	0.577	regulation of macromolecule metabolic process
GO:0080090	0.462	regulation of primary metabolic process
GO:0051171	0.461	regulation of nitrogen compound metabolic process
GO:0051246	0.417	regulation of protein metabolic process
GO:0048522	0.416	positive regulation of cellular process
GO:0010604	0.388	positive regulation of macromolecule metabolic process
GO:0050896	0.376	response to stimulus
GO:0065009	0.306	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0031982	0.995	vesicle
GO:0070013	0.992	intracellular organelle lumen
GO:0005773	0.960	vacuole
GO:0005576	0.955	extracellular region
GO:0000323	0.954	lytic vacuole
GO:0005764	0.934	lysosome
GO:0016020	0.922	membrane
GO:0005615	0.872	extracellular space
GO:0030141	0.868	secretory granule
GO:0005768	0.843	endosome
GO:0070062	0.832	extracellular exosome
GO:0071944	0.736	cell periphery
GO:0031090	0.698	organelle membrane
GO:0098588	0.671	bounding membrane of organelle
GO:0030659	0.561	cytoplasmic vesicle membrane
GO:0005886	0.412	plasma membrane
GO:0005774	0.364	vacuolar membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.23.-	1.000	Aspartic endopeptidases.
EC:3.4.22.-	0.368	Cysteine endopeptidases.

[back to server]