StarFunc result for job id P07355

User Input

>input (339 residues)
MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNIL
TNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKG
LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
EDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDM
LESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NMY6	0.998	0.998	1.110E-46	339	0.979	0.979	A6NMY6.pdb.gz	AXA2L_HUMAN Putative annexin A2-like protein OS=Homo sapiens OX=9606 GN=ANXA2P2 PE=5 SV=2
2	PDB:7p70A	0.945	0.788	1.170E-43	407	0.944	0.786	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
3	PDB:7p73A	0.936	0.756	4.428E-43	420	0.935	0.755	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
4	AFDB:P17785	0.939	0.939	5.690E-43	339	0.897	0.897	P17785.pdb.gz	ANXA2_CHICK Annexin A2 OS=Gallus gallus OX=9031 GN=ANXA2 PE=1 SV=2
5	PDB:5n7dA	0.941	0.754	1.295E-42	423	0.935	0.749	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
6	PDB:7qqnC	0.917	0.752	3.239E-41	414	0.938	0.768	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
7	PDB:7pc3A	0.901	0.755	6.720E-41	405	0.914	0.765	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
8	PDB:7nmiB	0.906	0.630	1.394E-40	488	0.906	0.629	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone
9	PDB:7pcbA	0.903	0.739	1.586E-40	415	0.912	0.745	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
10	PDB:6t58A	0.911	0.590	1.883E-40	524	0.926	0.599	6t58A.pdb.gz	Structure Determination of the Transactivation Domain of p53 in Complex with S100A4 Using Annexin A2 as a Crystallization Chaperone.
11	PDB:7pc5A	0.906	0.759	4.637E-40	405	0.912	0.763	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:7qqmA	0.904	0.744	1.004E-39	413	0.935	0.768	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	AFDB:Q7T3A8	0.919	0.916	9.103E-32	340	0.519	0.518	Q7T3A8.pdb.gz
14	AFDB:P14669	0.921	0.963	9.800E-30	324	0.454	0.475	P14669.pdb.gz	ANXA3_RAT Annexin A3 OS=Rattus norvegicus OX=10116 GN=Anxa3 PE=1 SV=4
15	AFDB:P09525	0.911	0.967	1.115E-29	319	0.460	0.489	P09525.pdb.gz	ANXA4_HUMAN Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4
16	AFDB:P12429	0.917	0.962	1.215E-29	323	0.448	0.471	P12429.pdb.gz	ANXA3_HUMAN Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3
17	AFDB:P81287	0.919	0.970	3.708E-29	321	0.437	0.461	P81287.pdb.gz	ANXA5_BOVIN Annexin A5 OS=Bos taurus OX=9913 GN=ANXA5 PE=1 SV=3
18	AFDB:P50995	0.917	0.618	5.227E-29	505	0.448	0.301	P50995.pdb.gz	ANX11_HUMAN Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1
19	AFDB:B5XAE0	0.907	0.969	5.696E-29	317	0.431	0.461	B5XAE0.pdb.gz	B5XAE0_SALSA Annexin OS=Salmo salar OX=8030 GN=ANXA5 PE=2 SV=1
20	AFDB:P07150	0.901	0.883	5.696E-29	346	0.510	0.500	P07150.pdb.gz	ANXA1_RAT Annexin A1 OS=Rattus norvegicus OX=10116 GN=Anxa1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NMY6	0.0	680	339	0.979	0.979	AXA2L_HUMAN Putative annexin A2-like protein OS=Homo sapiens OX=9606 GN=ANXA2P2 PE=5 SV=2
2	P04272	0.0	684	339	0.982	0.982	ANXA2_BOVIN Annexin A2 OS=Bos taurus OX=9913 GN=ANXA2 PE=1 SV=2
3	P07355	0.0	694	339	1.000	1.000	ANXA2_HUMAN Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2
4	P07356	0.0	679	339	0.976	0.976	ANXA2_MOUSE Annexin A2 OS=Mus musculus OX=10090 GN=Anxa2 PE=1 SV=2
5	P17785	0.0	633	339	0.897	0.897	ANXA2_CHICK Annexin A2 OS=Gallus gallus OX=9031 GN=ANXA2 PE=1 SV=2
6	P19620	0.0	677	339	0.979	0.979	ANXA2_PIG Annexin A2 OS=Sus scrofa OX=9823 GN=ANXA2 PE=1 SV=4
7	Q07936	0.0	676	339	0.968	0.968	ANXA2_RAT Annexin A2 OS=Rattus norvegicus OX=10116 GN=Anxa2 PE=1 SV=2
8	Q6TEQ7	0.0	686	339	0.988	0.988	ANXA2_CANLF Annexin A2 OS=Canis lupus familiaris OX=9615 GN=ANXA2 PE=1 SV=1
9	P07150	1.68e-119	350	346	0.510	0.500	ANXA1_RAT Annexin A1 OS=Rattus norvegicus OX=10116 GN=Anxa1 PE=1 SV=2
10	Q804H2	4.28e-119	348	340	0.543	0.541	Q804H2_DANRE Annexin OS=Danio rerio OX=7955 GN=anx1a PE=1 SV=1
11	P10107	8.54e-119	348	346	0.510	0.500	ANXA1_MOUSE Annexin A1 OS=Mus musculus OX=10090 GN=Anxa1 PE=1 SV=2
12	P04083	8.32e-117	343	346	0.516	0.506	ANXA1_HUMAN Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2
13	Q5TZZ9	8.32e-117	343	346	0.516	0.506	Q5TZZ9_HUMAN Annexin OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=1
14	P19619	1.33e-116	342	346	0.522	0.512	ANXA1_PIG Annexin A1 OS=Sus scrofa OX=9823 GN=ANXA1 PE=1 SV=3
15	P46193	2.10e-115	339	346	0.516	0.506	ANXA1_BOVIN Annexin A1 OS=Bos taurus OX=9913 GN=ANXA1 PE=1 SV=2
16	P97429	1.26e-104	311	319	0.475	0.505	ANXA4_MOUSE Annexin A4 OS=Mus musculus OX=10090 GN=Anxa4 PE=1 SV=4
17	P13214	2.20e-103	308	319	0.469	0.498	ANXA4_BOVIN Annexin A4 OS=Bos taurus OX=9913 GN=ANXA4 PE=1 SV=2
18	P09525	1.62e-102	306	319	0.460	0.489	ANXA4_HUMAN Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4
19	P17153	1.97e-100	300	321	0.451	0.477	ANXA5_CHICK Annexin A5 OS=Gallus gallus OX=9031 GN=ANXA5 PE=1 SV=2
20	P14669	7.83e-100	299	324	0.457	0.478	ANXA3_RAT Annexin A3 OS=Rattus norvegicus OX=10116 GN=Anxa3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00191 Annexin	4.7e-90	307.0	Annexin
2	PF18947 HAMP_2	58	15.1	HAMP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014373

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000015913	0.999	S100 calcium binding protein A10
2	61853.ENSNLEP00000012660	0.938	S100 calcium binding protein A4
3	61853.ENSNLEP00000015584	0.917	Plasminogen activator, tissue
4	61853.ENSNLEP00000013885	0.888	Plasminogen
5	61853.ENSNLEP00000004250	0.884	AHNAK nucleoprotein
6	61853.ENSNLEP00000012569	0.868	Belongs to the S-100 family.
7	61853.ENSNLEP00000022618	0.868	Belongs to the S-100 family.
8	61853.ENSNLEP00000012592	0.863	Dysferlin
9	61853.ENSNLEP00000017752	0.862	Proprotein convertase subtilisin/kexin type 9
10	61853.ENSNLEP00000018335	0.837	Cathepsin B
11	61853.ENSNLEP00000019881	0.816	annotation not available
12	61853.ENSNLEP00000012667	0.814	S100 calcium binding protein A2
13	61853.ENSNLEP00000001633	0.813	Annexin A1
14	61853.ENSNLEP00000012655	0.809	S100 calcium binding protein A6
15	61853.ENSNLEP00000023611	0.747	Prohibitin
16	61853.ENSNLEP00000015544	0.739	Galectin
17	61853.ENSNLEP00000008139	0.738	Secretory leukocyte peptidase inhibitor
18	61853.ENSNLEP00000005416	0.713	Synaptosomal-associated protein, 23kDa
19	61853.ENSNLEP00000010020	0.708	Cell division cycle 42
20	61853.ENSNLEP00000014017	0.703	May act as a scaffolding protein within caveolar membranes. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae (By similarity). Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner (By [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005543	0.999	phospholipid binding
GO:0043167	0.964	ion binding
GO:0005544	0.901	calcium-dependent phospholipid binding
GO:0098772	0.689	molecular function regulator activity
GO:0046872	0.572	metal ion binding
GO:0005509	0.440	calcium ion binding
GO:0035091	0.348	phosphatidylinositol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.990	cellular process
GO:0032501	0.985	multicellular organismal process
GO:0050794	0.984	regulation of cellular process
GO:0032502	0.982	developmental process
GO:0048518	0.977	positive regulation of biological process
GO:0051179	0.956	localization
GO:0048856	0.953	anatomical structure development
GO:0048522	0.950	positive regulation of cellular process
GO:0008152	0.948	metabolic process
GO:0060255	0.948	regulation of macromolecule metabolic process
GO:0050896	0.937	response to stimulus
GO:0071704	0.891	organic substance metabolic process
GO:0007275	0.889	multicellular organism development
GO:0080090	0.888	regulation of primary metabolic process
GO:0051171	0.888	regulation of nitrogen compound metabolic process
GO:0050792	0.877	regulation of viral process
GO:0051239	0.871	regulation of multicellular organismal process
GO:0051246	0.866	regulation of protein metabolic process
GO:0048523	0.852	negative regulation of cellular process
GO:0006810	0.845	transport
GO:0048731	0.813	system development
GO:0048513	0.802	animal organ development
GO:0045595	0.791	regulation of cell differentiation
GO:0051716	0.783	cellular response to stimulus
GO:0048583	0.780	regulation of response to stimulus
GO:0031323	0.778	regulation of cellular metabolic process
GO:0044419	0.775	biological process involved in interspecies interaction between organisms
GO:0051248	0.766	negative regulation of protein metabolic process
GO:0061041	0.763	regulation of wound healing
GO:0030154	0.762	cell differentiation
GO:0065009	0.752	regulation of molecular function
GO:0050878	0.746	regulation of body fluid levels
GO:0032101	0.721	regulation of response to external stimulus
GO:0010468	0.720	regulation of gene expression
GO:0051702	0.713	biological process involved in interaction with symbiont
GO:0009653	0.706	anatomical structure morphogenesis
GO:0032879	0.705	regulation of localization
GO:0031325	0.698	positive regulation of cellular metabolic process
GO:0023052	0.696	signaling
GO:0051050	0.694	positive regulation of transport
GO:0033036	0.688	macromolecule localization
GO:0010604	0.684	positive regulation of macromolecule metabolic process
GO:0009888	0.680	tissue development
GO:0051641	0.679	cellular localization
GO:0071702	0.672	organic substance transport
GO:0007154	0.671	cell communication
GO:0042221	0.670	response to chemical
GO:0051247	0.663	positive regulation of protein metabolic process
GO:0050818	0.656	regulation of coagulation
GO:0006816	0.656	calcium ion transport
GO:0031214	0.652	biomineral tissue development
GO:0030193	0.649	regulation of blood coagulation
GO:0008104	0.636	protein localization
GO:0042127	0.630	regulation of cell population proliferation
GO:0044237	0.623	cellular metabolic process
GO:2000026	0.618	regulation of multicellular organismal development
GO:0044093	0.616	positive regulation of molecular function
GO:0071840	0.605	cellular component organization or biogenesis
GO:0044238	0.602	primary metabolic process
GO:0010033	0.602	response to organic substance
GO:0051128	0.600	regulation of cellular component organization
GO:0043170	0.598	macromolecule metabolic process
GO:0006807	0.584	nitrogen compound metabolic process
GO:0051240	0.555	positive regulation of multicellular organismal process
GO:0030162	0.545	regulation of proteolysis
GO:0007165	0.540	signal transduction
GO:0016192	0.523	vesicle-mediated transport
GO:0051851	0.513	modulation by host of symbiont process
GO:0016043	0.511	cellular component organization
GO:0070509	0.472	calcium ion import
GO:0006950	0.435	response to stress
GO:0009719	0.419	response to endogenous stimulus
GO:0060348	0.395	bone development
GO:0031324	0.391	negative regulation of cellular metabolic process
GO:0023051	0.377	regulation of signaling
GO:0051130	0.373	positive regulation of cellular component organization
GO:1903317	0.350	regulation of protein maturation
GO:1901564	0.344	organonitrogen compound metabolic process
GO:0046903	0.318	secretion
GO:0044788	0.318	modulation by host of viral process
GO:0072359	0.317	circulatory system development
GO:0010646	0.306	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.995	membrane-bounded organelle
GO:0071944	0.994	cell periphery
GO:0016020	0.994	membrane
GO:0012505	0.994	endomembrane system
GO:0005737	0.993	cytoplasm
GO:0031982	0.993	vesicle
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0005576	0.960	extracellular region
GO:0005886	0.959	plasma membrane
GO:0032991	0.883	protein-containing complex
GO:0030054	0.881	cell junction
GO:0005634	0.850	nucleus
GO:0005615	0.813	extracellular space
GO:0045202	0.801	synapse
GO:0097708	0.783	intracellular vesicle
GO:0031410	0.768	cytoplasmic vesicle
GO:1903561	0.698	extracellular vesicle
GO:0062023	0.667	collagen-containing extracellular matrix
GO:0070062	0.624	extracellular exosome
GO:0005829	0.518	cytosol
GO:0005783	0.435	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]