StarFunc result for job id P07686

User Input

>input (556 residues)
MELCGLGLPRPPMLLALLLATLLAAMLALLTQVALVVQVAEAARAPSVSAKPGPALWPLP
LSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFGFYKWHHEPAEFQA
KTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVY
QDSYGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVD
DQSFPYQSITFPELSNKGSYSLSHVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGK
GQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKC
WESNPKIQDFMRQKGFGTDFKKLESFYIQKVLDIIATINKGSIVWQEVFDDKAKLAPGTI
VEVWKDSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQKQKQL
FIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERG
IAAQPLYAGYCNHENM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07686	1.000	1.000	0.000	556	1.000	1.000	P07686.pdb.gz	HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=4
2	PDB:5broA	0.878	0.997	3.998E-100	490	0.871	0.988	5broA.pdb.gz
3	AFDB:P20060	0.900	0.933	3.704E-97	536	0.709	0.735	P20060.pdb.gz	HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus musculus OX=10090 GN=Hexb PE=1 SV=2
4	AFDB:Q6AXR4	0.902	0.934	2.957E-95	537	0.689	0.713	Q6AXR4.pdb.gz	HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus OX=10116 GN=Hexb PE=2 SV=1
5	AFDB:A2BHD8	0.885	0.910	8.039E-87	541	0.585	0.601	A2BHD8.pdb.gz	A2BHD8_DANRE Beta-hexosaminidase OS=Danio rerio OX=7955 GN=fc04h11 PE=1 SV=1
6	AFDB:H3BP20	0.869	0.895	2.309E-79	540	0.522	0.537	H3BP20.pdb.gz	H3BP20_HUMAN Beta-hexosaminidase OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=1
7	AFDB:P29416	0.884	0.930	1.839E-78	528	0.516	0.544	P29416.pdb.gz	HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus musculus OX=10090 GN=Hexa PE=1 SV=2
8	PDB:2gjxA	0.862	0.973	4.527E-74	492	0.511	0.577	2gjxA.pdb.gz
9	AFDB:Q22492	0.861	0.863	1.725E-58	555	0.378	0.378	Q22492.pdb.gz	HEXA_CAEEL Beta-hexosaminidase A OS=Caenorhabditis elegans OX=6239 GN=hex-1 PE=1 SV=1
10	AFDB:P13723	0.820	0.855	2.777E-52	532	0.299	0.312	P13723.pdb.gz	HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum OX=44689 GN=hexa1 PE=1 SV=1
11	AFDB:A7WM73	0.813	0.834	1.110E-50	541	0.324	0.333	A7WM73.pdb.gz	HEXO1_ARATH Beta-hexosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=HEXO1 PE=1 SV=1
12	AFDB:Q8L7S6	0.808	0.839	1.662E-50	535	0.336	0.350	Q8L7S6.pdb.gz	HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana OX=3702 GN=HEXO3 PE=1 SV=1
13	PDB:6k35A	0.723	0.632	2.505E-35	640	0.236	0.205	6k35A.pdb.gz	NAG-thiazoline is a potent inhibitor of the Vibrio campbellii GH20 beta-N-Acetylglucosaminidase.
14	PDB:6je8A	0.685	0.805	1.135E-29	469	0.209	0.247	6je8A.pdb.gz	Crystallographic evidence for substrate-assisted catalysis of beta-N-acetylhexosaminidas from Akkermansia muciniphila.
15	PDB:5fl1A	0.497	0.403	7.922E-13	703	0.121	0.095	5fl1A.pdb.gz	Analysis of transition state mimicry by tight binding aminothiazoline inhibitors provides insight into catalysis by humanO-GlcNAcase.
16	PDB:1mqrA	0.483	0.411	1.895E-9	674	0.112	0.092	1mqrA.pdb.gz
17	PDB:1gqiA	0.447	0.364	1.509E-8	708	0.129	0.102	1gqiA.pdb.gz	The Structural Basis for Catalysis and Specificity of the Pseudomonas Cellulosa Alpha-Glucuronidase, Glca67A
18	PDB:4xwhA	0.478	0.382	2.844E-8	720	0.101	0.078	4xwhA.pdb.gz	Structural characterization of the alpha-N-acetylglucosaminidase, a key enzyme in the pathogenesis of Sanfilippo syndrome B.
19	PDB:5cltA	0.334	0.295	7.594E-7	646	0.110	0.094	5cltA.pdb.gz	Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose
20	PDB:5kzwA	0.309	0.216	4.279E-6	850	0.070	0.046	5kzwA.pdb.gz	The structure of human GAA: structural basis of Pompe disease

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3W3	0.0	605	529	0.514	0.541	A0A0S2Z3W3_HUMAN beta-N-acetylhexosaminidase (Fragment) OS=Homo sapiens OX=9606 GN=HEXA PE=2 SV=1
2	A2BHD8	0.0	669	541	0.576	0.591	A2BHD8_DANRE Beta-hexosaminidase OS=Danio rerio OX=7955 GN=fc04h11 PE=1 SV=1
3	F1QUU0	0.0	540	464	0.473	0.567	F1QUU0_DANRE beta-N-acetylhexosaminidase OS=Danio rerio OX=7955 GN=fc04h11 PE=1 SV=1
4	H3BP20	0.0	602	540	0.520	0.535	H3BP20_HUMAN Beta-hexosaminidase OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=1
5	H3BS10	0.0	583	509	0.498	0.544	H3BS10_HUMAN Beta-hexosaminidase OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=1
6	P06865	0.0	605	529	0.514	0.541	HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=2
7	P07686	0.0	1155	556	0.998	0.998	HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=4
8	P20060	0.0	861	536	0.709	0.735	HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus musculus OX=10090 GN=Hexb PE=1 SV=2
9	P29416	0.0	603	528	0.511	0.538	HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus musculus OX=10090 GN=Hexa PE=1 SV=2
10	Q6AXR4	0.0	840	537	0.707	0.732	HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus OX=10116 GN=Hexb PE=2 SV=1
11	Q22492	1.75e-130	394	555	0.356	0.357	HEXA_CAEEL Beta-hexosaminidase A OS=Caenorhabditis elegans OX=6239 GN=hex-1 PE=1 SV=1
12	P13723	4.05e-99	312	532	0.315	0.329	HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum OX=44689 GN=hexa1 PE=1 SV=1
13	Q8L7S6	2.93e-95	302	535	0.333	0.346	HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana OX=3702 GN=HEXO3 PE=1 SV=1
14	A7WM73	3.17e-92	295	541	0.329	0.338	HEXO1_ARATH Beta-hexosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=HEXO1 PE=1 SV=1
15	Q9SYK0	4.96e-91	292	580	0.358	0.343	HEXO2_ARATH Beta-hexosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=HEXO2 PE=1 SV=1
16	Q9W3C4	3.37e-73	247	622	0.318	0.285	Q9W3C4_DROME beta-N-acetylhexosaminidase OS=Drosophila melanogaster OX=7227 GN=Hexo2 PE=1 SV=1
17	Q8IRB6	1.81e-70	239	606	0.279	0.256	Q8IRB6_DROME beta-N-acetylhexosaminidase OS=Drosophila melanogaster OX=7227 GN=Hexo1 PE=1 SV=1
18	Q0E8H9	2.80e-70	239	622	0.279	0.249	Q0E8H9_DROME beta-N-acetylhexosaminidase OS=Drosophila melanogaster OX=7227 GN=Hexo1 PE=1 SV=1
19	Q8MSS9	1.08e-69	237	606	0.275	0.252	Q8MSS9_DROME beta-N-acetylhexosaminidase OS=Drosophila melanogaster OX=7227 GN=Hexo1 PE=2 SV=1
20	Q8WSF3	5.88e-67	231	660	0.286	0.241	FDL_DROME Probable beta-hexosaminidase fdl OS=Drosophila melanogaster OX=7227 GN=fdl PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14845 Glycohydro_20b2	1.8e-18	78.9	beta-acetyl hexosaminidase like
2	PF00728 Glyco_hydro_20	1.6e-88	309.0	Glycosyl hydrolase family 20, catalytic domain
3	PF02838 Glyco_hydro_20b	1.9	20.6	Glycosyl hydrolase family 20, domain 2
4	PF02709 Glyco_transf_7C	3e+02	12.6	N-terminal domain of galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261416

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268097	0.988	Beta-hexosaminidase subunit alpha
2	9606.ENSP00000349687	0.976	Ganglioside GM2 activator
3	9606.ENSP00000306920	0.962	Beta-galactosidase
4	9606.ENSP00000379680	0.958	Alpha-N-acetylgalactosaminidase
5	9606.ENSP00000218516	0.956	Galactosidase alpha
6	9606.ENSP00000356198	0.940	Chitotriosidase-1
7	9606.ENSP00000258145	0.932	N-acetylglucosamine-6-sulfatase
8	9606.ENSP00000477639	0.927	N-acetyl-D-glucosamine kinase
9	9606.ENSP00000358755	0.926	Acidic mammalian chitinase
10	9606.ENSP00000377303	0.915	N-acylglucosamine 2-epimerase
11	9606.ENSP00000379353	0.908	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
12	9606.ENSP00000366549	0.906	Lactosylceramide alpha-2,3-sialyltransferase
13	9606.ENSP00000479101	0.904	Ectoderm-neural cortex protein 1
14	9606.ENSP00000381699	0.903	Beta-1,3-galactosyltransferase 5
15	9606.ENSP00000390784	0.903	Beta-1,3-galactosyltransferase 4
16	9606.ENSP00000384794	0.902	Lactosylceramide 4-alpha-galactosyltransferase
17	9606.ENSP00000361110	0.900	Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
18	9606.ENSP00000337854	0.891	Hexosaminidase D
19	9606.ENSP00000341562	0.823	Beta-1,4 N-acetylgalactosaminyltransferase 1
20	9606.ENSP00000376532	0.820	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0004563	1.000	beta-N-acetylhexosaminidase activity
GO:0016758	0.945	hexosyltransferase activity
GO:0008194	0.906	UDP-glycosyltransferase activity
GO:0008375	0.477	acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:1901564	0.998	organonitrogen compound metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0009056	0.995	catabolic process
GO:1901135	0.995	carbohydrate derivative metabolic process
GO:1901575	0.987	organic substance catabolic process
GO:1901565	0.971	organonitrogen compound catabolic process
GO:0046466	0.970	membrane lipid catabolic process
GO:1901136	0.969	carbohydrate derivative catabolic process
GO:0006665	0.969	sphingolipid metabolic process
GO:0006022	0.965	aminoglycan metabolic process
GO:0030203	0.961	glycosaminoglycan metabolic process
GO:0043603	0.958	amide metabolic process
GO:0030149	0.957	sphingolipid catabolic process
GO:0006672	0.949	ceramide metabolic process
GO:0006687	0.945	glycosphingolipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005764	1.000	lysosome
GO:0012505	0.999	endomembrane system
GO:0005576	0.999	extracellular region
GO:0070013	0.994	intracellular organelle lumen
GO:0031982	0.991	vesicle
GO:0016020	0.975	membrane
GO:0005615	0.959	extracellular space
GO:0030141	0.957	secretory granule
GO:0070062	0.859	extracellular exosome
GO:0005775	0.836	vacuolar lumen
GO:0034774	0.759	secretory granule lumen
GO:0043202	0.733	lysosomal lumen
GO:0042582	0.683	azurophil granule
GO:0032991	0.528	protein-containing complex
GO:0005829	0.433	cytosol
GO:0031090	0.373	organelle membrane
GO:0098588	0.361	bounding membrane of organelle
GO:0035578	0.331	azurophil granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.52	1.000	beta-N-acetylhexosaminidase.
EC:2.4.1.-	0.945	Hexosyltransferases.

[back to server]