StarFunc result for job id P07737

User Input

>input (140 residues)
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07737	1.000	1.000	8.349E-29	140	1.000	1.000	P07737.pdb.gz	PROF1_HUMAN Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2
2	PDB:3chwP	0.972	0.979	2.116E-25	139	0.986	0.993	3chwP.pdb.gz	Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
3	AFDB:P35080	0.973	0.973	4.599E-21	140	0.614	0.614	P35080.pdb.gz	PROF2_HUMAN Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3
4	PDB:2vk3A	0.962	0.949	1.683E-18	142	0.614	0.606	2vk3A.pdb.gz
5	AFDB:Q9DAD6	0.935	0.955	3.778E-16	137	0.414	0.423	Q9DAD6.pdb.gz	PROF3_MOUSE Profilin-3 OS=Mus musculus OX=10090 GN=Pfn3 PE=1 SV=1
6	AFDB:E7F0A1	0.933	0.926	2.467E-15	141	0.343	0.340	E7F0A1.pdb.gz	E7F0A1_DANRE Profilin OS=Danio rerio OX=7955 GN=fa91a03 PE=1 SV=1
7	AFDB:Q9D6I3	0.706	0.757	6.724E-8	129	0.186	0.202	Q9D6I3.pdb.gz	PROF4_MOUSE Profilin-4 OS=Mus musculus OX=10090 GN=Pfn4 PE=1 SV=1
8	AFDB:P07274	0.718	0.789	9.014E-8	126	0.250	0.278	P07274.pdb.gz	PROF_YEAST Profilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFY1 PE=1 SV=2
9	PDB:1a0kA	0.734	0.785	9.942E-8	130	0.300	0.323	1a0kA.pdb.gz
10	PDB:1k0kA	0.709	0.783	1.333E-7	125	0.250	0.280	1k0kA.pdb.gz
11	PDB:7sbdC	0.731	0.755	1.787E-7	135	0.257	0.267	7sbdC.pdb.gz
12	AFDB:P68696	0.725	0.797	2.442E-7	126	0.200	0.222	P68696.pdb.gz	PRO1A_ACACA Profilin-1A OS=Acanthamoeba castellanii OX=5755 PE=1 SV=2
13	AFDB:P39825	0.743	0.811	2.590E-7	127	0.271	0.299	P39825.pdb.gz	PROF_SCHPO Profilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc3 PE=1 SV=1
14	PDB:6iqjB	0.719	0.763	2.856E-7	131	0.279	0.298	6iqjB.pdb.gz	Structural and computational examination of theArabidopsisprofilin-Poly-P complex reveals mechanistic details in profilin-regulated actin assembly.
15	AFDB:Q21193	0.715	0.784	2.912E-7	126	0.221	0.246	Q21193.pdb.gz	PROF3_CAEEL Profilin-3 OS=Caenorhabditis elegans OX=6239 GN=pfn-3 PE=2 SV=1
16	PDB:3d9yA	0.747	0.823	3.611E-7	126	0.250	0.278	3d9yA.pdb.gz
17	AFDB:Q42418	0.721	0.765	5.550E-7	131	0.271	0.290	Q42418.pdb.gz	PRF2_ARATH Profilin-2 OS=Arabidopsis thaliana OX=3702 GN=PRF2 PE=1 SV=1
18	PDB:1prqA	0.723	0.801	5.773E-7	125	0.193	0.216	1prqA.pdb.gz
19	PDB:5fefA	0.748	0.789	8.207E-7	132	0.257	0.273	5fefA.pdb.gz
20	PDB:6b6jA	0.742	0.760	9.785E-7	136	0.243	0.250	6b6jA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07737	8.88e-103	291	140	1.000	1.000	PROF1_HUMAN Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2
2	P62962	2.09e-98	280	140	0.957	0.957	PROF1_MOUSE Profilin-1 OS=Mus musculus OX=10090 GN=Pfn1 PE=1 SV=2
3	P62963	2.09e-98	280	140	0.957	0.957	PROF1_RAT Profilin-1 OS=Rattus norvegicus OX=10116 GN=Pfn1 PE=1 SV=2
4	Q9EPC6	1.76e-62	189	140	0.621	0.621	PROF2_RAT Profilin-2 OS=Rattus norvegicus OX=10116 GN=Pfn2 PE=1 SV=3
5	Q9JJV2	1.52e-61	187	140	0.614	0.614	PROF2_MOUSE Profilin-2 OS=Mus musculus OX=10090 GN=Pfn2 PE=1 SV=3
6	P35080	2.49e-61	186	140	0.614	0.614	PROF2_HUMAN Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3
7	Q9DAD6	1.40e-34	119	137	0.414	0.423	PROF3_MOUSE Profilin-3 OS=Mus musculus OX=10090 GN=Pfn3 PE=1 SV=1
8	E7F0A1	2.88e-29	105	141	0.350	0.348	E7F0A1_DANRE Profilin OS=Danio rerio OX=7955 GN=fa91a03 PE=1 SV=1
9	P07274	7.28e-05	42.0	126	0.279	0.310	PROF_YEAST Profilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFY1 PE=1 SV=2
10	P39825	1.17e-04	41.6	127	0.214	0.236	PROF_SCHPO Profilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc3 PE=1 SV=1
11	Q42449	5.55e-04	39.7	131	0.314	0.336	PRF1_ARATH Profilin-1 OS=Arabidopsis thaliana OX=3702 GN=PRF1 PE=1 SV=1
12	Q6FR43	8.80e-04	38.9	126	0.279	0.310	Q6FR43_CANGA Profilin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PFY1 PE=3 SV=1
13	Q5A786	0.49	31.6	126	0.157	0.175	Q5A786_CANAL Profilin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PFY1 PE=3 SV=1
14	Q8R3E3	0.61	32.0	446	0.121	0.038	WIPI1_MOUSE WD repeat domain phosphoinositide-interacting protein 1 OS=Mus musculus OX=10090 GN=Wipi1 PE=1 SV=1
15	P26200	1.3	30.4	124	0.164	0.185	PROF2_DICDI Profilin-2 OS=Dictyostelium discoideum OX=44689 GN=proB PE=1 SV=1
16	Q8T8M2	1.7	30.0	126	0.250	0.278	PROF3_DICDI Profilin-3 OS=Dictyostelium discoideum OX=44689 GN=proC PE=3 SV=1
17	H0Y6W5	2.7	30.0	860	0.121	0.020	H0Y6W5_HUMAN Basonuclin 2 (Fragment) OS=Homo sapiens OX=9606 GN=BNC2 PE=1 SV=1
18	Q6ZN30	2.8	30.0	1099	0.121	0.015	BNC2_HUMAN Zinc finger protein basonuclin-2 OS=Homo sapiens OX=9606 GN=BNC2 PE=1 SV=1
19	O05805	3.6	29.6	346	0.179	0.072	O05805_MYCTU Serine aminopeptidase S33 domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2854 PE=1 SV=1
20	Q13046	5.6	29.3	419	0.129	0.043	PSG7_HUMAN Pregnancy-specific beta-1-glycoprotein 7 OS=Homo sapiens OX=9606 GN=PSG7 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00235 Profilin	3.8e-23	93.5	Profilin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000021706

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000001117	0.977	Actin, beta
2	9593.ENSGGOP00000013697	0.963	Uncharacterized protein
3	9593.ENSGGOP00000017044	0.950	Cofilin 1 (non-muscle)
4	9593.ENSGGOP00000002821	0.946	Diaphanous-related formin 2
5	9593.ENSGGOP00000022941	0.928	Profilin 2
6	9593.ENSGGOP00000009657	0.903	Vasodilator stimulated phosphoprotein
7	9593.ENSGGOP00000019641	0.893	Uncharacterized protein
8	9593.ENSGGOP00000025079	0.893	Uncharacterized protein
9	9593.ENSGGOP00000027058	0.893	Uncharacterized protein
10	9593.ENSGGOP00000018436	0.891	Dishevelled associated activator of morphogenesis 1
11	9593.ENSGGOP00000019445	0.872	Profilin family, member 4
12	9593.ENSGGOP00000000915	0.863	Actin, alpha 1, skeletal muscle
13	9593.ENSGGOP00000002701	0.861	Ras homolog family member C
14	9593.ENSGGOP00000001093	0.848	Formin 1
15	9593.ENSGGOP00000024931	0.839	CAP, adenylate cyclase-associated protein 1 (yeast)
16	9593.ENSGGOP00000012527	0.831	Ras homolog family member A
17	9593.ENSGGOP00000019559	0.828	Cofilin 2 (muscle)
18	9593.ENSGGOP00000009416	0.807	Profilin 3
19	9593.ENSGGOP00000018024	0.806	Dishevelled associated activator of morphogenesis 2
20	9593.ENSGGOP00000005759	0.791	Enah/Vasp-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	0.999	actin binding
GO:0043168	0.997	anion binding
GO:1901981	0.996	phosphatidylinositol phosphate binding
GO:0005546	0.993	phosphatidylinositol-4,5-bisphosphate binding
GO:0003785	0.941	actin monomer binding
GO:0097159	0.590	organic cyclic compound binding
GO:1901363	0.589	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110053	0.995	regulation of actin filament organization
GO:0044087	0.994	regulation of cellular component biogenesis
GO:0016043	0.991	cellular component organization
GO:0048518	0.966	positive regulation of biological process
GO:0048522	0.959	positive regulation of cellular process
GO:0019222	0.956	regulation of metabolic process
GO:0048519	0.906	negative regulation of biological process
GO:0048523	0.888	negative regulation of cellular process
GO:0065008	0.884	regulation of biological quality
GO:0044089	0.864	positive regulation of cellular component biogenesis
GO:0010638	0.861	positive regulation of organelle organization
GO:0032233	0.853	positive regulation of actin filament bundle assembly
GO:0043254	0.843	regulation of protein-containing complex assembly
GO:0110020	0.822	regulation of actomyosin structure organization
GO:0030833	0.806	regulation of actin filament polymerization
GO:0040012	0.803	regulation of locomotion
GO:0051129	0.763	negative regulation of cellular component organization
GO:0051492	0.754	regulation of stress fiber assembly
GO:0060255	0.628	regulation of macromolecule metabolic process
GO:0080090	0.626	regulation of primary metabolic process
GO:0051171	0.626	regulation of nitrogen compound metabolic process
GO:0031323	0.622	regulation of cellular metabolic process
GO:0030334	0.622	regulation of cell migration
GO:0050896	0.472	response to stimulus
GO:0006996	0.436	organelle organization
GO:0032501	0.435	multicellular organismal process
GO:1902904	0.359	negative regulation of supramolecular fiber organization
GO:0010639	0.357	negative regulation of organelle organization
GO:0051494	0.346	negative regulation of cytoskeleton organization
GO:0065009	0.345	regulation of molecular function
GO:0051496	0.334	positive regulation of stress fiber assembly
GO:0031333	0.333	negative regulation of protein-containing complex assembly
GO:0048856	0.325	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005576	0.999	extracellular region
GO:0005829	0.999	cytosol
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016020	0.983	membrane
GO:0071944	0.973	cell periphery
GO:0031982	0.963	vesicle
GO:0005634	0.955	nucleus
GO:0070062	0.947	extracellular exosome
GO:0005886	0.925	plasma membrane
GO:0070161	0.868	anchoring junction
GO:0030055	0.819	cell-substrate junction
GO:0005925	0.805	focal adhesion
GO:0120025	0.715	plasma membrane bounded cell projection
GO:0043232	0.653	intracellular non-membrane-bounded organelle
GO:0045202	0.497	synapse
GO:0012505	0.386	endomembrane system
GO:0031410	0.378	cytoplasmic vesicle
GO:0070013	0.349	intracellular organelle lumen
GO:0005654	0.329	nucleoplasm
GO:0032991	0.306	protein-containing complex
GO:0005938	0.300	cell cortex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]