StarFunc result for job id P07738

User Input

>input (259 residues)
MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVL
NRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYN
VTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRG
KTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEA
IQAAIKKVEDQGKVKQAKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07738	1.000	1.000	9.959E-58	259	1.000	1.000	P07738.pdb.gz	PMGE_HUMAN Bisphosphoglycerate mutase OS=Homo sapiens OX=9606 GN=BPGM PE=1 SV=2
2	PDB:2h4zA	0.978	0.994	6.748E-53	255	0.985	1.000	2h4zA.pdb.gz	Seeing the process of histidine phosphorylation in human bisphosphoglycerate mutase.
3	AFDB:Q7TP58	0.972	0.638	1.073E-49	395	0.892	0.585	Q7TP58.pdb.gz	Q7TP58_RAT Phosphoglycerate mutase OS=Rattus norvegicus OX=10116 GN=Bpgm PE=1 SV=1
4	AFDB:P18669	0.952	0.971	4.931E-41	254	0.529	0.539	P18669.pdb.gz	PGAM1_HUMAN Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2
5	AFDB:Q7T3G4	0.943	0.958	3.023E-40	255	0.498	0.506	Q7T3G4.pdb.gz	Q7T3G4_DANRE Phosphoglycerate mutase OS=Danio rerio OX=7955 GN=zgc:63876 PE=1 SV=1
6	AFDB:O70250	0.945	0.966	5.877E-40	253	0.510	0.522	O70250.pdb.gz	PGAM2_MOUSE Phosphoglycerate mutase 2 OS=Mus musculus OX=10090 GN=Pgam2 PE=1 SV=3
7	AFDB:Q9VAN7	0.949	0.963	1.117E-35	255	0.483	0.490	Q9VAN7.pdb.gz	Q9VAN7_DROME Phosphoglycerate mutase OS=Drosophila melanogaster OX=7227 GN=Pglym78 PE=1 SV=2
8	AFDB:Q54NE6	0.907	0.943	1.605E-35	249	0.483	0.502	Q54NE6.pdb.gz	PGAM_DICDI Probable phosphoglycerate mutase OS=Dictyostelium discoideum OX=44689 GN=gpmA PE=1 SV=1
9	PDB:1yjxA	0.888	0.937	2.771E-35	245	0.506	0.535	1yjxA.pdb.gz	Crystal structure of human B-type phosphoglycerate mutase bound with citrate.
10	AFDB:O51602	0.916	0.955	4.458E-34	248	0.452	0.472	O51602.pdb.gz	GPMA_BORBU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=gpmA PE=1 SV=2
11	AFDB:P62707	0.899	0.931	7.229E-34	250	0.463	0.480	P62707.pdb.gz	GPMA_ECOLI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12) OX=83333 GN=gpmA PE=1 SV=2
12	AFDB:P00950	0.904	0.946	1.172E-33	247	0.463	0.486	P00950.pdb.gz	PMG1_YEAST Phosphoglycerate mutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPM1 PE=1 SV=3
13	PDB:4embA	0.860	0.907	4.692E-32	245	0.436	0.461	4embA.pdb.gz
14	PDB:1e58A	0.866	0.907	9.691E-32	247	0.436	0.457	1e58A.pdb.gz
15	PDB:1qhfA	0.856	0.921	1.234E-31	240	0.444	0.479	1qhfA.pdb.gz	Structure of a phosphoglycerate mutase:3-phosphoglyceric acid complex at 1.7 A.
16	PDB:1riiA	0.875	0.930	1.554E-29	243	0.405	0.432	1riiA.pdb.gz
17	PDB:1fztA	0.744	0.906	1.026E-20	211	0.355	0.436	1fztA.pdb.gz
18	PDB:6s2rA	0.655	0.718	3.526E-14	234	0.205	0.226	6s2rA.pdb.gz
19	PDB:1bifA	0.600	0.374	3.089E-12	432	0.193	0.116	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
20	PDB:1k6mA	0.583	0.362	8.631E-12	432	0.201	0.120	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07738	0.0	533	259	1.000	1.000	PMGE_HUMAN Bisphosphoglycerate mutase OS=Homo sapiens OX=9606 GN=BPGM PE=1 SV=2
2	P15327	0.0	503	259	0.923	0.923	PMGE_MOUSE Bisphosphoglycerate mutase OS=Mus musculus OX=10090 GN=Bpgm PE=1 SV=2
3	Q6P6G4	1.31e-180	498	258	0.907	0.911	Q6P6G4_RAT Phosphoglycerate mutase OS=Rattus norvegicus OX=10116 GN=Bpgm PE=1 SV=1
4	Q7TP58	1.70e-139	399	395	0.730	0.478	Q7TP58_RAT Phosphoglycerate mutase OS=Rattus norvegicus OX=10116 GN=Bpgm PE=1 SV=1
5	Q5ZLN1	6.34e-106	309	254	0.521	0.531	PGAM1_CHICK Phosphoglycerate mutase 1 OS=Gallus gallus OX=9031 GN=PGAM1 PE=1 SV=3
6	P15259	4.34e-102	299	253	0.506	0.518	PGAM2_HUMAN Phosphoglycerate mutase 2 OS=Homo sapiens OX=9606 GN=PGAM2 PE=1 SV=3
7	O70250	7.02e-102	298	253	0.510	0.522	PGAM2_MOUSE Phosphoglycerate mutase 2 OS=Mus musculus OX=10090 GN=Pgam2 PE=1 SV=3
8	P16290	3.82e-101	296	253	0.506	0.518	PGAM2_RAT Phosphoglycerate mutase 2 OS=Rattus norvegicus OX=10116 GN=Pgam2 PE=1 SV=2
9	Q7T3G4	1.40e-99	293	255	0.494	0.502	Q7T3G4_DANRE Phosphoglycerate mutase OS=Danio rerio OX=7955 GN=zgc:63876 PE=1 SV=1
10	P25113	1.82e-98	290	254	0.533	0.543	PGAM1_RAT Phosphoglycerate mutase 1 OS=Rattus norvegicus OX=10116 GN=Pgam1 PE=1 SV=4
11	Q9DBJ1	1.82e-98	290	254	0.533	0.543	PGAM1_MOUSE Phosphoglycerate mutase 1 OS=Mus musculus OX=10090 GN=Pgam1 PE=1 SV=3
12	P18669	7.94e-98	288	254	0.529	0.539	PGAM1_HUMAN Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2
13	Q8N0Y7	9.14e-93	275	254	0.514	0.524	PGAM4_HUMAN Probable phosphoglycerate mutase 4 OS=Homo sapiens OX=9606 GN=PGAM4 PE=3 SV=1
14	Q54NE6	3.10e-90	269	249	0.483	0.502	PGAM_DICDI Probable phosphoglycerate mutase OS=Dictyostelium discoideum OX=44689 GN=gpmA PE=1 SV=1
15	Q9VAN7	5.70e-84	253	255	0.483	0.490	Q9VAN7_DROME Phosphoglycerate mutase OS=Drosophila melanogaster OX=7227 GN=Pglym78 PE=1 SV=2
16	O51602	3.85e-83	251	248	0.459	0.480	GPMA_BORBU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=gpmA PE=1 SV=2
17	P62707	1.67e-80	244	250	0.459	0.476	GPMA_ECOLI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12) OX=83333 GN=gpmA PE=1 SV=2
18	Q6FUX8	1.61e-78	239	247	0.471	0.494	Q6FUX8_CANGA Phosphoglycerate mutase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GPM1 PE=3 SV=1
19	P00950	2.61e-77	236	247	0.463	0.486	PMG1_YEAST Phosphoglycerate mutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPM1 PE=1 SV=3
20	P82612	2.16e-74	228	248	0.459	0.480	PMGY_CANAL Phosphoglycerate mutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPM1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07825 Exc	69	14.8	Excisionase-like protein
2	PF00300 His_Phos_1	2.7e-30	117.1	Histidine phosphatase superfamily (branch 1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376840

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362413	0.975	Phosphoglycerate kinase 1
2	9606.ENSP00000305995	0.973	Phosphoglycerate kinase 2
3	9606.ENSP00000324105	0.967	Beta-enolase
4	9606.ENSP00000234590	0.966	Alpha-enolase
5	9606.ENSP00000437402	0.966	Gamma-enolase
6	9606.ENSP00000297283	0.963	Phosphoglycerate mutase 2
7	9606.ENSP00000229239	0.959	Glyceraldehyde-3-phosphate dehydrogenase
8	9606.ENSP00000222286	0.940	Glyceraldehyde-3-phosphate dehydrogenase, testis-specific
9	9606.ENSP00000358417	0.927	D-3-phosphoglycerate dehydrogenase
10	9606.ENSP00000361064	0.914	Multiple inositol polyphosphate phosphatase 1
11	9606.ENSP00000389175	0.914	Glycerate kinase
12	9606.ENSP00000412189	0.905	Phosphoglycerate mutase family member 4
13	9606.ENSP00000359991	0.904	Phosphoglycerate mutase 1
14	9606.ENSP00000405573	0.896	Glucose-6-phosphate isomerase
15	9606.ENSP00000473348	0.878	GDH/6PGL endoplasmic bifunctional protein
16	9606.ENSP00000321259	0.872	Transaldolase
17	9606.ENSP00000345555	0.851	Enolase 4
18	9606.ENSP00000377192	0.849	Glucose-6-phosphate 1-dehydrogenase
19	9606.ENSP00000416583	0.845	Deoxyribose-phosphate aldolase
20	9606.ENSP00000378669	0.835	Fructose-bisphosphate aldolase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016868	1.000	intramolecular transferase activity, phosphotransferases
GO:0005515	0.999	protein binding
GO:0004619	0.945	phosphoglycerate mutase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0009987	0.984	cellular process
GO:0032501	0.900	multicellular organismal process
GO:1901135	0.891	carbohydrate derivative metabolic process
GO:1901575	0.887	organic substance catabolic process
GO:0032502	0.786	developmental process
GO:0044238	0.749	primary metabolic process
GO:0044237	0.736	cellular metabolic process
GO:0005975	0.572	carbohydrate metabolic process
GO:0044281	0.567	small molecule metabolic process
GO:0006807	0.550	nitrogen compound metabolic process
GO:0034641	0.477	cellular nitrogen compound metabolic process
GO:0006139	0.466	nucleobase-containing compound metabolic process
GO:1901564	0.436	organonitrogen compound metabolic process
GO:0019637	0.432	organophosphate metabolic process
GO:0016052	0.423	carbohydrate catabolic process
GO:0006796	0.421	phosphate-containing compound metabolic process
GO:0006753	0.405	nucleoside phosphate metabolic process
GO:0006091	0.370	generation of precursor metabolites and energy
GO:0019693	0.358	ribose phosphate metabolic process
GO:0006163	0.356	purine nucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:0031982	0.991	vesicle
GO:0005576	0.989	extracellular region
GO:1903561	0.963	extracellular vesicle
GO:0005615	0.959	extracellular space
GO:0070062	0.954	extracellular exosome
GO:0043231	0.859	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.4.2.-	1.000	Phosphotransferases (phosphomutases).
RHEA:15901	0.945	(2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate
EC:5.4.2.1	0.945	Transferred entry: 5.4.2.11 and 5.4.2.12.

[back to server]