StarFunc result for job id P07741

User Input

>input (180 residues)
MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDY
IAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPG
QRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07741	1.000	1.000	3.802E-42	180	1.000	1.000	P07741.pdb.gz	APT_HUMAN Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT PE=1 SV=2
2	PDB:6fciA	0.969	0.974	2.711E-38	179	0.989	0.994	6fciA.pdb.gz	Structural Insights into the Forward and Reverse Enzymatic Reactions in Human Adenine Phosphoribosyltransferase.
3	AFDB:P08030	0.994	0.994	2.363E-37	180	0.828	0.828	P08030.pdb.gz	APT_MOUSE Adenine phosphoribosyltransferase OS=Mus musculus OX=10090 GN=Aprt PE=1 SV=2
4	AFDB:P49435	0.956	0.921	1.442E-26	187	0.444	0.428	P49435.pdb.gz	APT1_YEAST Adenine phosphoribosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APT1 PE=1 SV=3
5	AFDB:O42842	0.957	0.917	4.187E-26	188	0.428	0.410	O42842.pdb.gz	APT_SCHPO Adenine phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apt1 PE=3 SV=1
6	PDB:5vjpB	0.942	0.948	4.890E-26	179	0.444	0.447	5vjpB.pdb.gz	Synthesis of bis-Phosphate Iminoaltritol Enantiomers and Structural Characterization with Adenine Phosphoribosyltransferase.
7	AFDB:Q5ALX8	0.934	0.896	6.915E-26	188	0.400	0.383	Q5ALX8.pdb.gz	APT_CANAL Adenine phosphoribosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=APT1 PE=3 SV=1
8	AFDB:H3BQZ9	0.782	0.917	1.295E-25	153	0.756	0.889	H3BQZ9.pdb.gz	H3BQZ9_HUMAN Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT PE=1 SV=1
9	AFDB:Q9SU38	0.941	0.931	1.664E-25	182	0.417	0.412	Q9SU38.pdb.gz	APT4_ARATH Adenine phosphoribosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=APT4 PE=1 SV=1
10	AFDB:P36973	0.938	0.933	3.760E-25	181	0.400	0.398	P36973.pdb.gz	APT2_YEAST Adenine phosphoribosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APT2 PE=1 SV=2
11	AFDB:P31166	0.934	0.697	5.478E-25	243	0.406	0.300	P31166.pdb.gz	APT1_ARATH Adenine phosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APT1 PE=1 SV=2
12	PDB:2dy0A	0.918	0.908	1.198E-24	182	0.406	0.401	2dy0A.pdb.gz
13	AFDB:P69503	0.932	0.917	2.177E-24	183	0.411	0.404	P69503.pdb.gz	APT_ECOLI Adenine phosphoribosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=apt PE=1 SV=1
14	PDB:5vn4A	0.876	0.674	8.744E-18	237	0.300	0.228	5vn4A.pdb.gz	Crystal structure of adenine phosphoribosyl transferase from Trypanosoma brucei in complex with AMP, pyrophosphate, and ribose-5-phosphate
15	PDB:2ps1A	0.635	0.526	8.503E-9	224	0.144	0.116	2ps1A.pdb.gz	Ternary complex formation and induced asymmetry in orotate phosphoribosyltransferase.
16	PDB:2ehjA	0.460	0.402	8.275E-7	208	0.122	0.106	2ehjA.pdb.gz
17	PDB:1a95B	0.515	0.603	2.257E-6	150	0.183	0.220	1a95B.pdb.gz	Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
18	PDB:1oroA	0.570	0.496	6.156E-6	213	0.144	0.122	1oroA.pdb.gz	A flexible loop at the dimer interface is a part of the active site of the adjacent monomer of Escherichia coli orotate phosphoribosyltransferase.
19	PDB:5knxB	0.555	0.566	1.083E-5	176	0.150	0.153	5knxB.pdb.gz	Crystal Structures of Acyclic Nucleoside Phosphonates in Complex with Escherichia coli Hypoxanthine Phosphoribosyltransferase
20	PDB:5e38D	0.571	0.494	1.227E-5	213	0.189	0.160	5e38D.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07741	6.48e-129	360	180	1.000	1.000	APT_HUMAN Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT PE=1 SV=2
2	P36972	2.22e-111	316	180	0.867	0.867	APT_RAT Adenine phosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Aprt PE=1 SV=1
3	P08030	2.48e-107	306	180	0.828	0.828	APT_MOUSE Adenine phosphoribosyltransferase OS=Mus musculus OX=10090 GN=Aprt PE=1 SV=2
4	H3BQB1	3.39e-92	267	162	0.739	0.821	H3BQB1_HUMAN Adenine phosphoribosyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=APRT PE=1 SV=1
5	H3BQZ9	1.59e-88	258	153	0.778	0.915	H3BQZ9_HUMAN Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT PE=1 SV=1
6	H3BQF1	8.95e-74	220	148	0.594	0.723	H3BQF1_HUMAN Adenine phosphoribosyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=APRT PE=1 SV=8
7	Q9SUW2	1.12e-47	155	183	0.439	0.432	APT3_ARATH Adenine phosphoribosyltransferase 3 OS=Arabidopsis thaliana OX=3702 GN=APT3 PE=1 SV=1
8	Q9SU38	4.05e-46	151	182	0.417	0.412	APT4_ARATH Adenine phosphoribosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=APT4 PE=1 SV=1
9	O42842	2.83e-44	147	188	0.433	0.415	APT_SCHPO Adenine phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apt1 PE=3 SV=1
10	P31166	3.37e-44	148	243	0.406	0.300	APT1_ARATH Adenine phosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APT1 PE=1 SV=2
11	Q9LFP0	2.93e-43	144	191	0.406	0.382	APT5_ARATH Adenine phosphoribosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=APT5 PE=1 SV=1
12	Q5ALX8	6.39e-43	143	188	0.422	0.404	APT_CANAL Adenine phosphoribosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=APT1 PE=3 SV=1
13	P69503	5.84e-42	140	183	0.394	0.388	APT_ECOLI Adenine phosphoribosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=apt PE=1 SV=1
14	P49435	3.69e-41	139	187	0.439	0.422	APT1_YEAST Adenine phosphoribosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APT1 PE=1 SV=3
15	Q42563	5.75e-40	135	192	0.383	0.359	APT2_ARATH Adenine phosphoribosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=APT2 PE=1 SV=1
16	F4HSX1	1.02e-38	135	284	0.417	0.264	F4HSX1_ARATH adenine phosphoribosyltransferase OS=Arabidopsis thaliana OX=3702 GN=APT1 PE=1 SV=1
17	P63544	2.08e-38	131	170	0.383	0.406	APT_STRPN Adenine phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=apt PE=1 SV=1
18	P9WQ07	1.11e-32	117	212	0.411	0.349	APT_MYCTU Adenine phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=apt PE=1 SV=2
19	P36973	2.07e-30	111	181	0.400	0.398	APT2_YEAST Adenine phosphoribosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APT2 PE=1 SV=2
20	Q4Q9H8	2.10e-19	84.0	237	0.333	0.253	Q4Q9H8_LEIMA Adenine phosphoribosyltransferase OS=Leishmania major OX=5664 GN=APRT PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00156 Pribosyltran	1.9e-18	77.8	Phosphoribosyl transferase domain
2	PF15609 PRTase_2	21	16.1	Phosphoribosyl transferase
3	PF14681 UPRTase	10	17.1	Uracil phosphoribosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367615

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000236959	0.993	Bifunctional purine biosynthesis protein PURH
2	9606.ENSP00000485525	0.992	Adenylosuccinate lyase
3	9606.ENSP00000286621	0.989	Adenosine kinase
4	9606.ENSP00000419851	0.988	GMP synthase [glutamine-hydrolyzing]
5	9606.ENSP00000354532	0.983	Purine nucleoside phosphorylase
6	9606.ENSP00000298556	0.979	Hypoxanthine-guanine phosphoribosyltransferase
7	9606.ENSP00000238018	0.972	Guanine deaminase
8	9606.ENSP00000256578	0.967	AMP deaminase 2
9	9606.ENSP00000379802	0.964	AMP deaminase 3
10	9606.ENSP00000430075	0.963	AMP deaminase 1
11	9606.ENSP00000259727	0.955	GMP reductase 1
12	9606.ENSP00000346921	0.953	Adenylate kinase 2, mitochondrial
13	9606.ENSP00000355689	0.951	Guanylate kinase
14	9606.ENSP00000378743	0.948	Adenylate kinase 4, mitochondrial
15	9606.ENSP00000346577	0.944	Adenylate kinase isoenzyme 5
16	9606.ENSP00000369456	0.944	Inosine triphosphate pyrophosphatase
17	9606.ENSP00000371230	0.944	GTP:AMP phosphotransferase AK3, mitochondrial
18	9606.ENSP00000286648	0.943	Deoxycytidine kinase
19	9606.ENSP00000298545	0.942	Adenylate kinase 8
20	9606.ENSP00000410186	0.942	Adenylate kinase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003999	1.000	adenine phosphoribosyltransferase activity
GO:0016208	0.995	AMP binding
GO:0005515	0.981	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044238	0.992	primary metabolic process
GO:0071704	0.990	organic substance metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0034641	0.982	cellular nitrogen compound metabolic process
GO:1901564	0.980	organonitrogen compound metabolic process
GO:1901576	0.975	organic substance biosynthetic process
GO:1901360	0.974	organic cyclic compound metabolic process
GO:0046483	0.972	heterocycle metabolic process
GO:0006725	0.970	cellular aromatic compound metabolic process
GO:0044249	0.957	cellular biosynthetic process
GO:0055086	0.957	nucleobase-containing small molecule metabolic process
GO:0044271	0.922	cellular nitrogen compound biosynthetic process
GO:1901566	0.878	organonitrogen compound biosynthetic process
GO:0006796	0.799	phosphate-containing compound metabolic process
GO:0019637	0.791	organophosphate metabolic process
GO:0072521	0.750	purine-containing compound metabolic process
GO:1901362	0.735	organic cyclic compound biosynthetic process
GO:0065007	0.721	biological regulation
GO:0006753	0.710	nucleoside phosphate metabolic process
GO:0019438	0.692	aromatic compound biosynthetic process
GO:0050896	0.686	response to stimulus
GO:0034654	0.668	nucleobase-containing compound biosynthetic process
GO:0090407	0.545	organophosphate biosynthetic process
GO:0009117	0.534	nucleotide metabolic process
GO:1901135	0.480	carbohydrate derivative metabolic process
GO:1901293	0.459	nucleoside phosphate biosynthetic process
GO:0009161	0.458	ribonucleoside monophosphate metabolic process
GO:0050789	0.393	regulation of biological process
GO:0019693	0.384	ribose phosphate metabolic process
GO:0006163	0.379	purine nucleotide metabolic process
GO:0009259	0.372	ribonucleotide metabolic process
GO:0032502	0.363	developmental process
GO:0009150	0.361	purine ribonucleotide metabolic process
GO:0072522	0.359	purine-containing compound biosynthetic process
GO:0048856	0.351	anatomical structure development
GO:0050794	0.324	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005654	0.987	nucleoplasm
GO:0005576	0.974	extracellular region
GO:0070062	0.936	extracellular exosome
GO:0012505	0.835	endomembrane system
GO:0031410	0.671	cytoplasmic vesicle
GO:0099503	0.645	secretory vesicle
GO:0031983	0.584	vesicle lumen
GO:0030141	0.510	secretory granule
GO:0060205	0.385	cytoplasmic vesicle lumen
GO:0034774	0.328	secretory granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16609	1.000	AMP + diphosphate = 5-phospho-alpha-D-ribose 1-diphosphate + adenine
EC:2.4.2.7	1.000	adenine phosphoribosyltransferase.

[back to server]