StarFunc result for job id P07766

User Input

>input (207 residues)
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP
PPVPNPDYEPIRKGQRDLYSGLNQRRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07766	1.000	1.000	2.473E-38	207	1.000	1.000	P07766.pdb.gz	CD3E_HUMAN T-cell surface glycoprotein CD3 epsilon chain OS=Homo sapiens OX=9606 GN=CD3E PE=1 SV=2
2	AFDB:P22646	0.612	0.660	2.447E-21	189	0.580	0.635	P22646.pdb.gz	CD3E_MOUSE T-cell surface glycoprotein CD3 epsilon chain OS=Mus musculus OX=10090 GN=Cd3e PE=1 SV=2
3	AFDB:D4A5M2	0.552	0.602	4.228E-21	188	0.609	0.670	D4A5M2.pdb.gz	D4A5M2_RAT T-cell surface glycoprotein CD3 epsilon chain OS=Rattus norvegicus OX=10116 GN=Cd3e PE=4 SV=2
4	AFDB:A0A0G2K986	0.500	0.552	2.634E-19	184	0.556	0.625	A0A0G2K986.pdb.gz	A0A0G2K986_RAT T-cell surface glycoprotein CD3 epsilon chain OS=Rattus norvegicus OX=10116 GN=Cd3e PE=4 SV=1
5	AFDB:Q3LFS9	0.288	0.186	1.562E-6	341	0.135	0.082	Q3LFS9.pdb.gz	Q3LFS9_MOUSE CEA cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=2
6	AFDB:Q925P2	0.296	0.130	4.663E-6	520	0.140	0.056	Q925P2.pdb.gz	CEAM2_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ceacam2 PE=1 SV=3
7	AFDB:P31809	0.296	0.129	7.581E-6	521	0.140	0.056	P31809.pdb.gz	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
8	AFDB:Q80ZD7	0.313	0.157	8.056E-6	493	0.159	0.067	Q80ZD7.pdb.gz	AMGO1_RAT Amphoterin-induced protein 1 OS=Rattus norvegicus OX=10116 GN=Amigo1 PE=1 SV=1
9	AFDB:P13688	0.298	0.129	1.670E-5	526	0.135	0.053	P13688.pdb.gz	CEAM1_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CEACAM1 PE=1 SV=2
10	AFDB:Q86WK6	0.328	0.171	2.004E-5	493	0.155	0.065	Q86WK6.pdb.gz	AMGO1_HUMAN Amphoterin-induced protein 1 OS=Homo sapiens OX=9606 GN=AMIGO1 PE=1 SV=1
11	PDB:7phrD	0.239	0.409	5.704E-4	108	0.130	0.250	7phrD.pdb.gz	Structure of a fully assembled tumor-specific T cell receptor ligated by pMHC.
12	PDB:5oj2B	0.218	0.074	1.344E-2	692	0.097	0.029	5oj2B.pdb.gz
13	PDB:8e4cC	0.265	0.363	2.468E-2	142	0.140	0.204	8e4cC.pdb.gz
14	PDB:6okpN	0.201	0.338	2.623E-2	104	0.082	0.163	6okpN.pdb.gz	Broad and Potent Neutralizing Antibodies Recognize the Silent Face of the HIV Envelope.
15	PDB:2qhrL	0.212	0.204	2.962E-2	218	0.087	0.083	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
16	PDB:1fdlL	0.220	0.215	3.345E-2	214	0.068	0.065	1fdlL.pdb.gz
17	PDB:6cplA	0.223	0.248	3.777E-2	180	0.072	0.083	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
18	PDB:1f11A	0.210	0.202	4.265E-2	216	0.058	0.056	1f11A.pdb.gz
19	PDB:4ydvL	0.209	0.210	4.265E-2	206	0.068	0.068	4ydvL.pdb.gz	Human Non-neutralizing HIV-1 Envelope Monoclonal Antibodies Limit the Number of Founder Viruses during SHIV Mucosal Infection in Rhesus Macaques.
20	PDB:1ct8A	0.205	0.200	4.816E-2	214	0.072	0.070	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07766	3.11e-155	429	207	1.000	1.000	CD3E_HUMAN T-cell surface glycoprotein CD3 epsilon chain OS=Homo sapiens OX=9606 GN=CD3E PE=1 SV=2
2	E9PSH8	2.07e-147	409	201	0.966	0.995	E9PSH8_HUMAN CD3 epsilon subunit of T-cell receptor complex OS=Homo sapiens OX=9606 GN=CD3E PE=1 SV=1
3	P22646	1.44e-68	209	189	0.594	0.651	CD3E_MOUSE T-cell surface glycoprotein CD3 epsilon chain OS=Mus musculus OX=10090 GN=Cd3e PE=1 SV=2
4	D4A5M2	9.15e-68	207	189	0.618	0.677	D4A5M2_RAT T-cell surface glycoprotein CD3 epsilon chain OS=Rattus norvegicus OX=10116 GN=Cd3e PE=4 SV=2
5	A0A0G2K986	9.93e-61	189	184	0.556	0.625	A0A0G2K986_RAT T-cell surface glycoprotein CD3 epsilon chain OS=Rattus norvegicus OX=10116 GN=Cd3e PE=4 SV=1
6	A0A8I6AAG4	1.39e-58	189	336	0.560	0.345	A0A8I6AAG4_RAT T-cell surface glycoprotein CD3 epsilon chain OS=Rattus norvegicus OX=10116 GN=Cd3e PE=4 SV=1
7	P70069	6.02e-38	131	175	0.367	0.434	P70069_CHICK CD3 epsilon protein OS=Gallus gallus OX=9031 GN=CD3 epsilon PE=1 SV=1
8	B3VMQ8	1.15e-37	130	175	0.367	0.434	B3VMQ8_CHICK CD3 epsilon chain OS=Gallus gallus OX=9031 GN=CD3e PE=2 SV=1
9	B0YIY5	3.13e-05	45.1	182	0.208	0.236	B0YIY5_HUMAN T-cell surface glycoprotein CD3 gamma chain OS=Homo sapiens OX=9606 GN=CD3G PE=2 SV=1
10	P09693	3.13e-05	45.1	182	0.208	0.236	CD3G_HUMAN T-cell surface glycoprotein CD3 gamma chain OS=Homo sapiens OX=9606 GN=CD3G PE=1 SV=1
11	Q90768	4.98e-04	41.6	175	0.092	0.109	Q90768_CHICK CD3 glycoprotein OS=Gallus gallus OX=9031 GN=CD3D PE=1 SV=1
12	Q6PW00	5.08e-04	41.6	175	0.092	0.109	Q6PW00_CHICK CD3 glycoprotein OS=Gallus gallus OX=9031 PE=2 SV=1
13	Q7M730	0.042	36.2	228	0.111	0.101	SCN4B_RAT Sodium channel subunit beta-4 OS=Rattus norvegicus OX=10116 GN=Scn4b PE=1 SV=1
14	M9PF17	0.059	36.2	362	0.126	0.072	M9PF17_DROME Defective proboscis extension response 10, isoform D OS=Drosophila melanogaster OX=7227 GN=dpr10 PE=4 SV=1
15	Q8MS24	0.074	35.8	350	0.126	0.074	Q8MS24_DROME RE37920p OS=Drosophila melanogaster OX=7227 GN=dpr10 PE=2 SV=1
16	Q9VT83	0.078	35.8	408	0.126	0.064	Q9VT83_DROME Defective proboscis extension response 10, isoform A OS=Drosophila melanogaster OX=7227 GN=dpr10 PE=1 SV=2
17	P04235	0.11	34.7	173	0.116	0.139	CD3D_MOUSE T-cell surface glycoprotein CD3 delta chain OS=Mus musculus OX=10090 GN=Cd3d PE=1 SV=1
18	P11942	0.11	34.7	182	0.140	0.159	CD3G_MOUSE T-cell surface glycoprotein CD3 gamma chain OS=Mus musculus OX=10090 GN=Cd3g PE=1 SV=1
19	Q7M729	0.13	35.0	228	0.106	0.096	SCN4B_MOUSE Sodium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Scn4b PE=1 SV=1
20	Q02955	0.26	34.3	576	0.145	0.052	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13895 Ig_2	40	15.9	Immunoglobulin domain
2	PF13927 Ig_3	9.9	18.1	Immunoglobulin domain
3	PF16680 Ig_4	6.6e-13	60.4	T-cell surface glycoprotein CD3 delta chain
4	PF16681 Ig_5	5.1e-32	121.5	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
5	PF02189 ITAM	0.057	25.0	Immunoreceptor tyrosine-based activation motif
6	PF12409 P5-ATPase	2.5e+02	13.2	P5-type ATPase cation transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354566

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264972	0.999	Tyrosine-protein kinase ZAP-70
2	9606.ENSP00000300692	0.999	T-cell surface glycoprotein CD3 delta chain
3	9606.ENSP00000354782	0.999	T-cell surface glycoprotein CD3 zeta chain
4	9606.ENSP00000431445	0.999	T-cell surface glycoprotein CD3 gamma chain
5	9606.ENSP00000364907	0.997	Tyrosine-protein kinase SYK
6	9606.ENSP00000337825	0.993	Tyrosine-protein kinase Lck
7	9606.ENSP00000398655	0.991	Tyrosine-protein kinase ITK/TSK
8	9606.ENSP00000386559	0.987	T-cell surface glycoprotein CD8 alpha chain
9	9606.ENSP00000411355	0.987	Receptor-type tyrosine-protein phosphatase C
10	9606.ENSP00000011653	0.984	T-cell surface glycoprotein CD4
11	9606.ENSP00000324890	0.980	T-cell-specific surface glycoprotein CD28
12	9606.ENSP00000331172	0.974	T-cell surface glycoprotein CD8 beta chain
13	9606.ENSP00000295756	0.965	T-cell receptor-associated transmembrane adapter 1
14	9606.ENSP00000046794	0.962	Lymphocyte cytosolic protein 2
15	9606.ENSP00000216223	0.961	Interleukin-2 receptor subunit beta
16	9606.ENSP00000226730	0.961	Interleukin-2
17	9606.ENSP00000332049	0.961	T-lymphocyte activation antigen CD86
18	9606.ENSP00000363318	0.958	Cytokine receptor common subunit gamma
19	9606.ENSP00000369293	0.957	Interleukin-2 receptor subunit alpha
20	9606.ENSP00000264246	0.954	T-lymphocyte activation antigen CD80

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0017124	1.000	SH3 domain binding
GO:0005102	0.427	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.996	signal transduction
GO:1903037	0.989	regulation of leukocyte cell-cell adhesion
GO:0045785	0.989	positive regulation of cell adhesion
GO:0050863	0.989	regulation of T cell activation
GO:0051251	0.989	positive regulation of lymphocyte activation
GO:0007166	0.988	cell surface receptor signaling pathway
GO:0032944	0.985	regulation of mononuclear cell proliferation
GO:0042102	0.976	positive regulation of T cell proliferation
GO:0048583	0.939	regulation of response to stimulus
GO:0010468	0.936	regulation of gene expression
GO:0009893	0.882	positive regulation of metabolic process
GO:0010604	0.874	positive regulation of macromolecule metabolic process
GO:0048519	0.856	negative regulation of biological process
GO:0023051	0.834	regulation of signaling
GO:0010646	0.834	regulation of cell communication
GO:0002376	0.785	immune system process
GO:0010628	0.763	positive regulation of gene expression
GO:0009966	0.724	regulation of signal transduction
GO:0071840	0.661	cellular component organization or biogenesis
GO:0032501	0.597	multicellular organismal process
GO:0001775	0.587	cell activation
GO:0045321	0.584	leukocyte activation
GO:0048856	0.436	anatomical structure development
GO:0016043	0.434	cellular component organization
GO:0009892	0.422	negative regulation of metabolic process
GO:0046649	0.419	lymphocyte activation
GO:0048584	0.408	positive regulation of response to stimulus
GO:0050776	0.386	regulation of immune response
GO:0080090	0.385	regulation of primary metabolic process
GO:0051171	0.384	regulation of nitrogen compound metabolic process
GO:0031323	0.371	regulation of cellular metabolic process
GO:0048523	0.330	negative regulation of cellular process
GO:0042110	0.326	T cell activation
GO:0010605	0.306	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0032991	0.986	protein-containing complex
GO:0005794	0.956	Golgi apparatus
GO:0005783	0.954	endoplasmic reticulum
GO:0009986	0.891	cell surface
GO:0098796	0.732	membrane protein complex
GO:0098797	0.717	plasma membrane protein complex
GO:0098802	0.711	plasma membrane signaling receptor complex
GO:0098552	0.663	side of membrane
GO:0031982	0.628	vesicle
GO:0031410	0.549	cytoplasmic vesicle
GO:0009897	0.514	external side of plasma membrane
GO:0042101	0.502	T cell receptor complex
GO:0042105	0.423	alpha-beta T cell receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]