StarFunc result for job id P07814

User Input

>input (1512 residues)
MATLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLAR
VATTAGLYGSNLMEHTEIDHWLEFSATKLSSCDSFTSTINELNHCLSLRTYLVGNSLSLA
DLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVSTTKARVAPEK
KQDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMK
AEREQRIDSKHRKNPIEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCK
IQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYI
WEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGS
SRSVVNMEWDKIWAFNKKVIDPVAPRYVALLKKEVIPVNVPEAQEEMKEVAKHPKNPEVG
LKPVWYSPKVFIEGADAETFSEGEMVTFINWGNLNITKIHKNADGKIISLDAKLNLENKD
YKKTTKVTWLAETTHALPIPVICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELMLGDPC
LKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLIYIPDGHTKEMPTSGSKEKTK
VEATKNETSAPFKERPTPSLNNNCTTSEDSLVLYNRVAVQGDVVRELKAKKAPKEDVDAA
VKQLLSLKAEYKEKTGQEYKPGNPPAEIGQNISSNSSASILESKSLYDEVAAQGEVVRKL
KAEKSPKAKINEAVECLLSLKAQYKEKTGKEYIPGQPPLSQSSDSSPTRNSEPAGLETPE
AKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAED
KDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGLEAKK
EENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPM
FVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDL
PIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEEL
LAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPK
IPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDK
EALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFV
AVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSG
KIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKN
PAKYYTLFGRSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07814	1.000	1.000	0.000	1512	1.000	1.000	P07814.pdb.gz	SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5
2	AFDB:P28668	0.435	0.389	0.000	1714	0.563	0.497	P28668.pdb.gz	SYEP_DROME Bifunctional glutamate/proline--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=GluProRS PE=1 SV=2
3	AFDB:Q8CGC7	0.478	0.478	0.000	1512	0.894	0.894	Q8CGC7.pdb.gz	SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus OX=10090 GN=Eprs1 PE=1 SV=4
4	AFDB:O82462	0.337	0.697	5.618E-82	719	0.197	0.414	O82462.pdb.gz	SYEC_ARATH Glutamate--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At5g26710 PE=1 SV=1
5	AFDB:O13775	0.343	0.718	6.036E-81	716	0.199	0.420	O13775.pdb.gz	SYEC_SCHPO Probable glutamate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gus1 PE=1 SV=1
6	AFDB:P46655	0.336	0.707	9.999E-79	708	0.201	0.429	P46655.pdb.gz	SYEC_YEAST Glutamate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUS1 PE=1 SV=3
7	AFDB:O60155	0.326	0.682	1.371E-70	716	0.196	0.415	O60155.pdb.gz	PRS1_SCHPO Putative proline--tRNA ligase C19C7.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prs1 PE=3 SV=1
8	AFDB:P38708	0.327	0.712	4.926E-68	688	0.198	0.435	P38708.pdb.gz	YHI0_YEAST Putative proline--tRNA ligase YHR020W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHR020W PE=1 SV=1
9	AFDB:Q5BBD0	0.328	0.825	1.273E-66	594	0.203	0.517	Q5BBD0.pdb.gz	Q5BBD0_EMENI proline--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02150 PE=3 SV=1
10	AFDB:Q587C5	0.340	0.831	3.762E-66	607	0.173	0.430	Q587C5.pdb.gz	Q587C5_TRYB2 glutamate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.450 PE=3 SV=1
11	PDB:1nj1A	0.297	0.945	5.233E-47	463	0.112	0.365	1nj1A.pdb.gz	The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases
12	PDB:4jyzA	0.311	0.840	2.729E-46	542	0.118	0.328	4jyzA.pdb.gz	Structural and Mechanistic Basis for Enhanced Translational Efficiency by 2-Thiouridine at the tRNA Anticodon Wobble Position.
13	PDB:2hz7A	0.303	0.787	2.698E-44	556	0.102	0.277	2hz7A.pdb.gz
14	PDB:4h3sA	0.308	0.754	6.832E-44	585	0.118	0.306	4h3sA.pdb.gz	The Structure of Yeast Glutaminyl-tRNA Synthetase and Modeling of Its Interaction with tRNA.
15	PDB:4ye6A	0.312	0.639	3.554E-38	709	0.124	0.265	4ye6A.pdb.gz
16	PDB:1qf6A	0.213	0.475	2.428E-21	641	0.054	0.126	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site
17	PDB:3ugtC	0.216	0.697	7.240E-18	427	0.045	0.159	3ugtC.pdb.gz	Yeast mitochondrial threonyl-tRNA synthetase recognizes tRNA isoacceptors by distinct mechanisms and promotes CUN codon reassignment.
18	PDB:5e6mA	0.212	0.554	7.387E-17	519	0.054	0.156	5e6mA.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation
19	PDB:1atiA	0.212	0.664	1.372E-16	437	0.042	0.144	1atiA.pdb.gz	Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus.
20	PDB:5e6mB	0.207	0.558	3.300E-16	506	0.040	0.119	5e6mB.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O13775	0.0	584	716	0.197	0.416	SYEC_SCHPO Probable glutamate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gus1 PE=1 SV=1
2	O60155	0.0	611	716	0.197	0.416	PRS1_SCHPO Putative proline--tRNA ligase C19C7.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prs1 PE=3 SV=1
3	O82462	0.0	598	719	0.202	0.426	SYEC_ARATH Glutamate--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At5g26710 PE=1 SV=1
4	P07814	0.0	3148	1512	1.000	1.000	SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5
5	P28668	0.0	859	1714	0.284	0.251	SYEP_DROME Bifunctional glutamate/proline--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=GluProRS PE=1 SV=2
6	P38708	0.0	612	688	0.196	0.430	YHI0_YEAST Putative proline--tRNA ligase YHR020W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHR020W PE=1 SV=1
7	P46655	0.0	563	708	0.196	0.418	SYEC_YEAST Glutamate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUS1 PE=1 SV=3
8	Q5BBD0	0.0	576	594	0.189	0.481	Q5BBD0_EMENI proline--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02150 PE=3 SV=1
9	Q8CGC7	0.0	2804	1512	0.894	0.894	SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus OX=10090 GN=Eprs1 PE=1 SV=4
10	Q9M1R2	0.0	569	530	0.185	0.528	SYPC_ARATH Proline--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At3g62120 PE=1 SV=1
11	Q8I5R7	1.97e-174	542	746	0.177	0.359	SYP_PLAF7 Proline--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=proRS PE=1 SV=1
12	Q587C5	1.90e-149	471	607	0.159	0.395	Q587C5_TRYB2 glutamate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.450 PE=3 SV=1
13	Q9FYR6	1.79e-117	382	543	0.128	0.357	SYPM_ARATH Proline--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA6 PE=2 SV=1
14	P00962	3.34e-88	301	554	0.118	0.323	SYQ_ECOLI Glutamine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=glnS PE=1 SV=3
15	O26708	3.36e-86	292	482	0.110	0.344	SYP_METTH Proline--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=proS PE=1 SV=1
16	P13188	6.82e-76	272	809	0.106	0.199	SYQ_YEAST Glutamine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLN4 PE=1 SV=2
17	B4DDN1	4.01e-73	259	630	0.120	0.287	B4DDN1_HUMAN glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
18	Q96AW5	1.07e-72	260	717	0.120	0.252	Q96AW5_HUMAN glutamine--tRNA ligase (Fragment) OS=Homo sapiens OX=9606 GN=QARS PE=2 SV=2
19	P47897	1.61e-72	261	775	0.120	0.234	SYQ_HUMAN Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
20	Q9Y105	2.42e-72	261	778	0.112	0.219	SYQ_DROME Probable glutamine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=GlnRS PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00043 GST_C	0.59	21.7	Glutathione S-transferase, C-terminal domain
2	PF13410 GST_C_2	4.9e+02	12.1	Glutathione S-transferase, C-terminal domain
3	PF14497 GST_C_3	1.7e+02	13.8	Glutathione S-transferase, C-terminal domain
4	PF03129 HGTP_anticodon	2e-13	61.7	Anticodon binding domain
5	PF09180 ProRS-C_1	2.6e-18	77.4	Prolyl-tRNA synthetase, C-terminal
6	PF00749 tRNA-synt_1c	4.8e-122	418.4	tRNA synthetases class I (E and Q), catalytic domain
7	PF03950 tRNA-synt_1c_C	1.3e-34	131.1	tRNA synthetases class I (E and Q), anti-codon binding domain
8	PF01406 tRNA-synt_1e	59	14.5	tRNA synthetases class I (C) catalytic domain
9	PF00587 tRNA-synt_2b	4.4e-14	64.4	tRNA synthetase class II core domain (G, H, P, S and T)
10	PF00458 WHEP-TRS	6.1e-66	229.7	WHEP-TRS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355890

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223029	0.999	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
2	9606.ENSP00000231572	0.999	Arginine--tRNA ligase, cytoplasmic
3	9606.ENSP00000262027	0.999	Methionine--tRNA ligase, cytoplasmic
4	9606.ENSP00000264161	0.999	Aspartate--tRNA ligase, cytoplasmic
5	9606.ENSP00000307567	0.999	Glutamine--tRNA ligase
6	9606.ENSP00000325448	0.999	Lysine--tRNA ligase
7	9606.ENSP00000358635	0.999	Heterogeneous nuclear ribonucleoprotein Q
8	9606.ENSP00000364794	0.999	Isoleucine--tRNA ligase, cytoplasmic
9	9606.ENSP00000369038	0.999	Eukaryotic translation elongation factor 1 epsilon-1
10	9606.ENSP00000375730	0.999	60S ribosomal protein L13a
11	9606.ENSP00000377954	0.999	Leucine--tRNA ligase, cytoplasmic
12	9606.ENSP00000378191	0.999	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1
13	9606.ENSP00000362576	0.998	Tyrosine--tRNA ligase, cytoplasmic
14	9606.ENSP00000360327	0.997	Probable proline--tRNA ligase, mitochondrial
15	9606.ENSP00000229239	0.996	Glyceraldehyde-3-phosphate dehydrogenase
16	9606.ENSP00000256854	0.996	Asparagine--tRNA ligase, cytoplasmic
17	9606.ENSP00000281828	0.994	phenylalanyl-tRNA synthetase beta subunit
18	9606.ENSP00000373918	0.994	Glycine--tRNA ligase
19	9606.ENSP00000367498	0.993	Leucine-rich repeat-containing protein 47
20	9606.ENSP00000364815	0.989	Valine--tRNA ligase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004827	0.998	proline-tRNA ligase activity
GO:0003676	0.987	nucleic acid binding
GO:0003723	0.981	RNA binding
GO:0042802	0.885	identical protein binding
GO:0043169	0.873	cation binding
GO:0019899	0.866	enzyme binding
GO:0046872	0.851	metal ion binding
GO:0046983	0.849	protein dimerization activity
GO:0008270	0.828	zinc ion binding
GO:0004818	0.817	glutamate-tRNA ligase activity
GO:0042803	0.813	protein homodimerization activity
GO:0035613	0.715	RNA stem-loop binding
GO:0051020	0.711	GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0016070	0.990	RNA metabolic process
GO:0043603	0.975	amide metabolic process
GO:0006412	0.974	translation
GO:0050789	0.957	regulation of biological process
GO:0043039	0.955	tRNA aminoacylation
GO:0006418	0.954	tRNA aminoacylation for protein translation
GO:0050794	0.931	regulation of cellular process
GO:0080090	0.916	regulation of primary metabolic process
GO:0060255	0.915	regulation of macromolecule metabolic process
GO:0051171	0.823	regulation of nitrogen compound metabolic process
GO:0031323	0.785	regulation of cellular metabolic process
GO:0050896	0.778	response to stimulus
GO:0048523	0.680	negative regulation of cellular process
GO:0031326	0.674	regulation of cellular biosynthetic process
GO:0010468	0.668	regulation of gene expression
GO:0010556	0.656	regulation of macromolecule biosynthetic process
GO:0006433	0.521	prolyl-tRNA aminoacylation
GO:0051246	0.504	regulation of protein metabolic process
GO:0051248	0.489	negative regulation of protein metabolic process
GO:0031324	0.463	negative regulation of cellular metabolic process
GO:0051716	0.446	cellular response to stimulus
GO:0009890	0.435	negative regulation of biosynthetic process
GO:0034248	0.421	regulation of amide metabolic process
GO:0010033	0.419	response to organic substance
GO:0070887	0.417	cellular response to chemical stimulus
GO:0010608	0.415	post-transcriptional regulation of gene expression
GO:0006417	0.412	regulation of translation
GO:0006950	0.400	response to stress
GO:0071840	0.392	cellular component organization or biogenesis
GO:0010558	0.377	negative regulation of macromolecule biosynthetic process
GO:0031327	0.370	negative regulation of cellular biosynthetic process
GO:0016043	0.351	cellular component organization
GO:0071310	0.341	cellular response to organic substance
GO:0032879	0.334	regulation of localization
GO:0009605	0.330	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0017101	0.995	aminoacyl-tRNA synthetase multienzyme complex
GO:0005737	0.990	cytoplasm
GO:0005829	0.979	cytosol
GO:1990904	0.782	ribonucleoprotein complex
GO:0043229	0.684	intracellular organelle
GO:0043231	0.555	intracellular membrane-bounded organelle
GO:0097452	0.483	GAIT complex
GO:0070013	0.432	intracellular organelle lumen
GO:0005634	0.405	nucleus
GO:0005886	0.387	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14305	0.998	ATP + L-proline + tRNA(Pro) = AMP + diphosphate + L-prolyl-tRNA(Pro)
EC:6.1.1.15	0.998	proline--tRNA ligase.
RHEA:23540	0.817	ATP + L-glutamate + tRNA(Glu) = AMP + diphosphate + L-glutamyl-tRNA(Glu)
EC:6.1.1.17	0.817	glutamate--tRNA ligase.

[back to server]