StarFunc result for job id P07864

User Input

>input (332 residues)
MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKG
EMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSI
IPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGV
HPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYE
IIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGV
SDVVKINLNSEEEALFKKSAETLWNIQKDLIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07864	1.000	1.000	1.997E-70	332	1.000	1.000	P07864.pdb.gz	LDHC_HUMAN L-lactate dehydrogenase C chain OS=Homo sapiens OX=9606 GN=LDHC PE=1 SV=4
2	PDB:7epmA	0.970	0.961	1.422E-61	335	0.985	0.976	7epmA.pdb.gz	Identification of human LDHC4 as a potential target for anticancer drug discovery.
3	AFDB:P00338	0.997	0.997	2.182E-61	332	0.753	0.753	P00338.pdb.gz	LDHA_HUMAN L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2
4	AFDB:P00342	0.997	0.997	2.604E-61	332	0.741	0.741	P00342.pdb.gz	LDHC_MOUSE L-lactate dehydrogenase C chain OS=Mus musculus OX=10090 GN=Ldhc PE=1 SV=2
5	AFDB:P00340	0.994	0.994	1.275E-59	332	0.711	0.711	P00340.pdb.gz	LDHA_CHICK L-lactate dehydrogenase A chain OS=Gallus gallus OX=9031 GN=LDHA PE=1 SV=3
6	AFDB:Q9PVK5	0.995	0.992	1.810E-58	333	0.684	0.682	Q9PVK5.pdb.gz	LDHA_DANRE L-lactate dehydrogenase A chain OS=Danio rerio OX=7955 GN=ldha PE=2 SV=3
7	AFDB:P07195	0.996	0.990	3.264E-58	334	0.696	0.692	P07195.pdb.gz	LDHB_HUMAN L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2
8	AFDB:Q6ZMR3	0.996	0.996	3.883E-57	332	0.663	0.663	Q6ZMR3.pdb.gz	LDH6A_HUMAN L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=1 SV=1
9	AFDB:Q9BYZ2	0.997	0.869	4.369E-57	381	0.672	0.585	Q9BYZ2.pdb.gz	LDH6B_HUMAN L-lactate dehydrogenase A-like 6B OS=Homo sapiens OX=9606 GN=LDHAL6B PE=1 SV=3
10	AFDB:B5X4K4	0.994	0.988	2.415E-56	334	0.657	0.653	B5X4K4.pdb.gz	B5X4K4_SALSA L-lactate dehydrogenase OS=Salmo salar OX=8030 GN=LDHB PE=2 SV=1
11	PDB:4qsmA	0.987	0.987	3.010E-56	332	0.750	0.750	4qsmA.pdb.gz	Structures of lactate dehydrogenase A (LDHA) in apo, ternary and inhibitor-bound forms.
12	PDB:7dbjA	0.975	0.972	7.289E-56	333	0.693	0.691	7dbjA.pdb.gz	Identification of the first highly selective inhibitor of human lactate dehydrogenase B.
13	AFDB:Q8BVP2	0.995	0.865	4.092E-55	382	0.614	0.534	Q8BVP2.pdb.gz	Q8BVP2_MOUSE L-lactate dehydrogenase OS=Mus musculus OX=10090 GN=Ldhal6b PE=1 SV=1
14	PDB:2ldxA	0.939	0.942	2.045E-46	331	0.726	0.728	2ldxA.pdb.gz
15	PDB:1ldnA	0.886	0.929	6.026E-34	316	0.355	0.373	1ldnA.pdb.gz	Structure of a ternary complex of an allosteric lactate dehydrogenase from Bacillus stearothermophilus at 2.5 A resolution.
16	PDB:1ldbA	0.839	0.945	6.329E-31	294	0.334	0.378	1ldbA.pdb.gz	Structure determination and refinement of Bacillus stearothermophilus lactate dehydrogenase.
17	PDB:1oc4A	0.862	0.907	7.454E-27	315	0.271	0.286	1oc4A.pdb.gz	Crystal Structure of Plasmodium Berghei Lactate Dehydrogenase Indicates the Unique Structural Differences of These Enzymes are Shared Across the Plasmodium Genus
18	PDB:5nfrA	0.855	0.904	2.154E-26	313	0.256	0.272	5nfrA.pdb.gz
19	PDB:4i1iA	0.806	0.835	3.821E-21	320	0.214	0.222	4i1iA.pdb.gz	Crystal structure of a putative Cytosolic malate dehydrogenase from Leishmania major Friedlin in complex with NAD
20	PDB:5nueB	0.806	0.806	1.104E-20	332	0.214	0.214	5nueB.pdb.gz	Self-protection of cytosolic malate dehydrogenase against oxidative stress in Arabidopsis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00338	0.0	540	332	0.753	0.753	LDHA_HUMAN L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2
2	P00340	0.0	504	332	0.714	0.714	LDHA_CHICK L-lactate dehydrogenase A chain OS=Gallus gallus OX=9031 GN=LDHA PE=1 SV=3
3	P00342	0.0	531	332	0.741	0.741	LDHC_MOUSE L-lactate dehydrogenase C chain OS=Mus musculus OX=10090 GN=Ldhc PE=1 SV=2
4	P04642	0.0	535	332	0.747	0.747	LDHA_RAT L-lactate dehydrogenase A chain OS=Rattus norvegicus OX=10116 GN=Ldha PE=1 SV=1
5	P06151	0.0	531	332	0.747	0.747	LDHA_MOUSE L-lactate dehydrogenase A chain OS=Mus musculus OX=10090 GN=Ldha PE=1 SV=3
6	P07864	0.0	673	332	1.000	1.000	LDHC_HUMAN L-lactate dehydrogenase C chain OS=Homo sapiens OX=9606 GN=LDHC PE=1 SV=4
7	A0A5F9ZHM4	5.82e-174	488	341	0.696	0.677	A0A5F9ZHM4_HUMAN L-lactate dehydrogenase OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=1
8	P07195	6.35e-174	487	334	0.696	0.692	LDHB_HUMAN L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2
9	Q5U077	6.35e-174	487	334	0.696	0.692	Q5U077_HUMAN L-lactate dehydrogenase OS=Homo sapiens OX=9606 GN=LDHB PE=2 SV=1
10	P42123	9.85e-174	487	334	0.699	0.695	LDHB_RAT L-lactate dehydrogenase B chain OS=Rattus norvegicus OX=10116 GN=Ldhb PE=1 SV=2
11	P16125	1.16e-173	486	334	0.699	0.695	LDHB_MOUSE L-lactate dehydrogenase B chain OS=Mus musculus OX=10090 GN=Ldhb PE=1 SV=2
12	Q9BYZ2	1.21e-169	478	381	0.672	0.585	LDH6B_HUMAN L-lactate dehydrogenase A-like 6B OS=Homo sapiens OX=9606 GN=LDHAL6B PE=1 SV=3
13	Q6ZMR3	5.55e-168	472	332	0.663	0.663	LDH6A_HUMAN L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=1 SV=1
14	P00337	6.35e-168	472	333	0.675	0.673	LDHB_CHICK L-lactate dehydrogenase B chain OS=Gallus gallus OX=9031 GN=LDHB PE=1 SV=3
15	Q9PVK5	4.26e-164	462	333	0.687	0.685	LDHA_DANRE L-lactate dehydrogenase A chain OS=Danio rerio OX=7955 GN=ldha PE=2 SV=3
16	W5ULQ0	7.97e-162	456	333	0.687	0.685	W5ULQ0_ICTPU L-lactate dehydrogenase OS=Ictalurus punctatus OX=7998 GN=ldha PE=2 SV=1
17	Q8BVP2	5.47e-159	451	382	0.614	0.534	Q8BVP2_MOUSE L-lactate dehydrogenase OS=Mus musculus OX=10090 GN=Ldhal6b PE=1 SV=1
18	C0HAI2	3.55e-157	445	334	0.666	0.662	C0HAI2_SALSA L-lactate dehydrogenase OS=Salmo salar OX=8030 GN=LDHB PE=2 SV=1
19	B5X4K4	1.15e-155	441	334	0.657	0.653	B5X4K4_SALSA L-lactate dehydrogenase OS=Salmo salar OX=8030 GN=LDHB PE=2 SV=1
20	E3TG57	1.60e-137	393	291	0.593	0.677	E3TG57_ICTPU L-lactate dehydrogenase OS=Ictalurus punctatus OX=7998 GN=LDHA PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02056 Glyco_hydro_4	11	17.1	Family 4 glycosyl hydrolase
2	PF02866 Ldh_1_C	2.9e-23	94.2	lactate/malate dehydrogenase, alpha/beta C-terminal domain
3	PF00056 Ldh_1_N	1.3e-44	163.2	lactate/malate dehydrogenase, NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437783

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300051	0.960	Probable D-lactate dehydrogenase, mitochondrial
2	9606.ENSP00000377532	0.938	Pyruvate carboxylase, mitochondrial
3	9606.ENSP00000359539	0.934	Aspartate aminotransferase, cytoplasmic
4	9606.ENSP00000321070	0.923	NAD-dependent malic enzyme, mitochondrial
5	9606.ENSP00000339933	0.921	Pyruvate kinase PKLR
6	9606.ENSP00000405573	0.918	Glucose-6-phosphate isomerase
7	9606.ENSP00000245206	0.909	Aspartate aminotransferase, mitochondrial
8	9606.ENSP00000377192	0.903	Glucose-6-phosphate 1-dehydrogenase
9	9606.ENSP00000320171	0.900	Pyruvate kinase PKM
10	9606.ENSP00000379386	0.896	Lactate dehydrogenase B
11	9606.ENSP00000321259	0.895	Transaldolase
12	9606.ENSP00000445175	0.895	Lactate dehydrogenase A
13	9606.ENSP00000473348	0.887	GDH/6PGL endoplasmic bifunctional protein
14	9606.ENSP00000295266	0.858	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
15	9606.ENSP00000440246	0.836	NADP-dependent malic enzyme, mitochondrial
16	9606.ENSP00000363988	0.831	Belongs to the class I fructose-bisphosphate aldolase family
17	9606.ENSP00000378669	0.822	Fructose-bisphosphate aldolase A
18	9606.ENSP00000226253	0.821	Belongs to the class I fructose-bisphosphate aldolase family
19	9606.ENSP00000359976	0.818	Cystathionine gamma-lyase
20	9606.ENSP00000231420	0.817	Alanine--glyoxylate aminotransferase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004459	1.000	L-lactate dehydrogenase activity
GO:0005488	0.998	binding
GO:0005515	0.994	protein binding
GO:0042802	0.599	identical protein binding
GO:1901363	0.418	heterocyclic compound binding
GO:0097159	0.386	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0019752	0.992	carboxylic acid metabolic process
GO:1901615	0.988	organic hydroxy compound metabolic process
GO:0006089	0.984	lactate metabolic process
GO:0006090	0.922	pyruvate metabolic process
GO:0044238	0.855	primary metabolic process
GO:0006807	0.748	nitrogen compound metabolic process
GO:1901564	0.455	organonitrogen compound metabolic process
GO:0034641	0.414	cellular nitrogen compound metabolic process
GO:0006163	0.379	purine nucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0005576	0.984	extracellular region
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0005634	0.974	nucleus
GO:0070062	0.956	extracellular exosome
GO:0070013	0.358	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23444	1.000	(S)-lactate + NAD(+) = H(+) + NADH + pyruvate
EC:1.1.1.27	1.000	L-lactate dehydrogenase.

[back to server]