StarFunc result for job id P07900

User Input

>input (732 residues)
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE
GDDDTSRMEEVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RD80	0.889	0.899	0.000	724	0.857	0.866	A0A024RD80.pdb.gz
2	AFDB:A0A060XFW6	0.903	0.856	0.000	773	0.851	0.806	A0A060XFW6.pdb.gz	A0A060XFW6_ONCMY Histidine kinase/HSP90-like ATPase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028101001 PE=3 SV=1
3	AFDB:A0A1D5P5R0	0.876	0.882	0.000	727	0.910	0.916	A0A1D5P5R0.pdb.gz
4	AFDB:P02828	0.894	0.912	0.000	717	0.769	0.785	P02828.pdb.gz	HSP83_DROME Heat shock protein 83 OS=Drosophila melanogaster OX=7227 GN=Hsp83 PE=1 SV=1
5	AFDB:P07901	0.985	0.984	0.000	733	0.992	0.990	P07901.pdb.gz	HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4
6	AFDB:P27323	0.901	0.942	0.000	700	0.693	0.724	P27323.pdb.gz	HS901_ARATH Heat shock protein 90-1 OS=Arabidopsis thaliana OX=3702 GN=HSP90-1 PE=1 SV=3
7	AFDB:Q0Q0I7	0.888	0.928	0.000	700	0.687	0.719	Q0Q0I7.pdb.gz	Q0Q0I7_WHEAT Heat shock protein 90 OS=Triticum aestivum OX=4565 GN=HSP90-2 PE=1 SV=1
8	AFDB:Q18688	0.899	0.938	0.000	702	0.738	0.769	Q18688.pdb.gz	HSP90_CAEEL Heat shock protein 90 OS=Caenorhabditis elegans OX=6239 GN=daf-21 PE=1 SV=1
9	AFDB:Q90474	0.901	0.910	0.000	725	0.844	0.852	Q90474.pdb.gz	H90A1_DANRE Heat shock protein HSP 90-alpha 1 OS=Danio rerio OX=7955 GN=hsp90a.1 PE=1 SV=3
10	AFDB:Q9BLC5	0.906	0.926	0.000	716	0.820	0.838	Q9BLC5.pdb.gz	HSP83_BOMMO Heat shock protein 83 OS=Bombyx mori OX=7091 GN=Hsp83 PE=1 SV=1
11	PDB:5fwkA	0.854	0.978	5.625E-98	638	0.776	0.890	5fwkA.pdb.gz	Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
12	PDB:7kw7B	0.768	0.890	1.014E-96	628	0.850	0.990	7kw7B.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
13	PDB:2cg9B	0.815	0.963	2.683E-70	618	0.545	0.646	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
14	PDB:2iopA	0.480	0.562	2.685E-51	618	0.343	0.406	2iopA.pdb.gz	Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
15	PDB:5tthA	0.606	0.654	5.909E-51	671	0.281	0.307	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
16	PDB:7kclB	0.714	0.840	1.691E-50	614	0.281	0.336	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
17	PDB:5tthB	0.691	0.806	2.605E-49	621	0.275	0.324	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
18	PDB:1y4uB	0.353	0.553	4.910E-44	454	0.281	0.454	1y4uB.pdb.gz
19	PDB:6rkwD	0.281	0.265	1.332E-10	781	0.109	0.102	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
20	PDB:7p8vA	0.309	0.600	5.227E-10	331	0.086	0.190	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060XFW6	1194	773	0.835	0.790	A0A060XFW6_ONCMY Histidine kinase/HSP90-like ATPase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028101001 PE=3 SV=1
2	A0A0G2JH20	1414	705	0.951	0.987	A0A0G2JH20_RABIT Heat shock protein 90 alpha family class A member 1 OS=Oryctolagus cuniculus OX=9986 GN=HSP90AA1 PE=3 SV=2
3	A0A1D5PUL6	1435	728	0.960	0.966	A0A1D5PUL6_CHICK Heat shock protein 90 alpha family class A member 1 OS=Gallus gallus OX=9031 GN=HSP90AA1 PE=3 SV=1
4	B9R8A7	655	816	0.482	0.433	B9R8A7_RICCO Endoplasmin, putative OS=Ricinus communis OX=3988 GN=RCOM_1598250 PE=3 SV=1
5	C7G492	1435	728	0.960	0.966	C7G492_COTJA Heat shock protein 90kDa alpha (Cytosolic), class A member 1 OS=Coturnix japonica OX=93934 GN=HSP90AA1 PE=2 SV=1
6	C7G496	1433	728	0.958	0.963	C7G496_COTJA Heat shock protein 90kDa alpha (Cytosolic), class A member 1 OS=Coturnix japonica OX=93934 GN=HSP90AA1 PE=3 SV=1
7	F4JFN3	583	799	0.418	0.383	HS906_ARATH Heat shock protein 90-6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HSP90-6 PE=1 SV=1
8	F4K6B6	625	728	0.425	0.427	F4K6B6_ARATH Heat shock protein 81-2 OS=Arabidopsis thaliana OX=3702 GN=HSP81-2 PE=1 SV=1
9	O03986	641	699	0.425	0.445	HS904_ARATH Heat shock protein 90-4 OS=Arabidopsis thaliana OX=3702 GN=HSP90-4 PE=1 SV=1
10	O57521	1207	725	0.844	0.852	HS90B_DANRE Heat shock protein HSP 90-beta OS=Danio rerio OX=7955 GN=hsp90ab1 PE=1 SV=2
11	P02828	1144	717	0.769	0.785	HSP83_DROME Heat shock protein 83 OS=Drosophila melanogaster OX=7227 GN=Hsp83 PE=1 SV=1
12	P02829	829	709	0.597	0.616	HSP82_YEAST ATP-dependent molecular chaperone HSP82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSP82 PE=1 SV=1
13	P07900	1496	732	1.000	1.000	HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5
14	P07901	1481	733	0.992	0.990	HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4
15	P08238	1181	724	0.840	0.849	HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4
16	P11499	1188	724	0.844	0.854	HS90B_MOUSE Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3
17	P11501	1432	728	0.959	0.964	HS90A_CHICK Heat shock protein HSP 90-alpha OS=Gallus gallus OX=9031 GN=HSP90AA1 PE=3 SV=3
18	P12861	860	703	0.597	0.622	HSP83_TRYBB Heat shock protein 83 OS=Trypanosoma brucei brucei OX=5702 GN=HSP83 PE=1 SV=1
19	P15108	545	705	0.376	0.390	HSC82_YEAST ATP-dependent molecular chaperone HSC82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSC82 PE=1 SV=4
20	P27323	639	700	0.439	0.459	HS901_ARATH Heat shock protein 90-1 OS=Arabidopsis thaliana OX=3702 GN=HSP90-1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02518 HATPase_c	5.4e-11	54.4	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
2	PF13589 HATPase_c_3	5.2e-09	47.6	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF00183 HSP90	3.5e-229	773.8	Hsp90 protein
4	PF10158 LOH1CR12	3.5e+02	12.6	Tumour suppressor protein
5	PF02535 Zip	2.8e+02	12.1	ZIP Zinc transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335153

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000001008	0.999	Peptidyl-prolyl cis-trans isomerase FKBP4
2	9606.ENSP00000012443	0.999	Serine/threonine-protein phosphatase 5
3	9606.ENSP00000216479	0.999	Activator of 90 kDa heat shock protein ATPase homolog 1
4	9606.ENSP00000219548	0.999	E3 ubiquitin-protein ligase CHIP
5	9606.ENSP00000222005	0.999	Hsp90 co-chaperone Cdc37
6	9606.ENSP00000231509	0.999	Glucocorticoid receptor
7	9606.ENSP00000242057	0.999	Aryl hydrocarbon receptor
8	9606.ENSP00000251849	0.999	RAF proto-oncogene serine/threonine-protein kinase
9	9606.ENSP00000254322	0.999	DnaJ homolog subfamily B member 1
10	9606.ENSP00000257904	0.999	Cyclin-dependent kinase 4
11	9606.ENSP00000264657	0.999	Signal transducer and activator of transcription 3
12	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
13	9606.ENSP00000269571	0.999	Receptor tyrosine-protein kinase erbB-2
14	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
15	9606.ENSP00000279146	0.999	AH receptor-interacting protein
16	9606.ENSP00000297494	0.999	Nitric oxide synthase, endothelial
17	9606.ENSP00000298910	0.999	Leucine-rich repeat serine/threonine-protein kinase 2
18	9606.ENSP00000302961	0.999	Heat shock protein family A member 4
19	9606.ENSP00000303754	0.999	Peptidyl-prolyl cis-trans isomerase D
20	9606.ENSP00000309572	0.999	Telomerase reverse transcriptase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0003824	0.907	catalytic activity
GO:0097159	0.628	organic cyclic compound binding
GO:1901363	0.627	heterocyclic compound binding
GO:0042802	0.581	identical protein binding
GO:0051082	0.513	unfolded protein binding
GO:0019899	0.431	enzyme binding
GO:0016887	0.398	ATP hydrolysis activity
GO:0003676	0.357	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0009987	0.988	cellular process
GO:0065007	0.971	biological regulation
GO:0050789	0.962	regulation of biological process
GO:0050794	0.899	regulation of cellular process
GO:0048518	0.632	positive regulation of biological process
GO:0048522	0.624	positive regulation of cellular process
GO:0008152	0.572	metabolic process
GO:0071704	0.539	organic substance metabolic process
GO:0019222	0.526	regulation of metabolic process
GO:0060255	0.479	regulation of macromolecule metabolic process
GO:0031323	0.468	regulation of cellular metabolic process
GO:0051171	0.441	regulation of nitrogen compound metabolic process
GO:0006950	0.436	response to stress
GO:0080090	0.436	regulation of primary metabolic process
GO:0006807	0.428	nitrogen compound metabolic process
GO:0044237	0.424	cellular metabolic process
GO:0042221	0.421	response to chemical
GO:0071840	0.415	cellular component organization or biogenesis
GO:0051716	0.410	cellular response to stimulus
GO:0016043	0.408	cellular component organization
GO:0044238	0.360	primary metabolic process
GO:0048583	0.331	regulation of response to stimulus
GO:0009893	0.317	positive regulation of metabolic process
GO:0043170	0.316	macromolecule metabolic process
GO:0010604	0.310	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.991	cytosol
GO:0016020	0.959	membrane
GO:0043226	0.933	organelle
GO:0032991	0.892	protein-containing complex
GO:0005634	0.848	nucleus
GO:0071944	0.409	cell periphery
GO:0070013	0.369	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.398	ATP + H2O = ADP + H(+) + phosphate

[back to server]