StarFunc result for job id P07902

User Input

>input (379 residues)
MSRSGTDPQQRQQASEADAAAATFRANDHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQ
LLKTVPRHDPLNPLCPGAIRANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAK
SARGVCKVMCFHPWSDVTLPLMSVPEIRAVVDAWASVTEELGAQYPWVQIFENKGAMMGC
SNPHPHCQVWASSFLPDIAQREERSQQAYKSQHGEPLLMEYSRQELLRKERLVLTSEHWL
VLVPFWATWPYQTLLLPRRHVRRLPELTPAERDDLASIMKKLLTKYDNLFETSFPYSMGW
HGAPTGSEAGANWNHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRA
LPEVHYHLGQKDRETATIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07902	1.000	1.000	3.250E-81	379	1.000	1.000	P07902.pdb.gz	GALT_HUMAN Galactose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=GALT PE=1 SV=3
2	AFDB:P43424	0.993	0.993	2.799E-75	379	0.889	0.889	P43424.pdb.gz	GALT_RAT Galactose-1-phosphate uridylyltransferase OS=Rattus norvegicus OX=10116 GN=Galt PE=2 SV=1
3	PDB:6gqdA	0.879	0.968	4.183E-69	344	0.892	0.983	6gqdA.pdb.gz	Structure of human galactose-1-phosphate uridylyltransferase (GALT), with crystallization epitope mutations A21Y:A22T:T23P:R25L
4	AFDB:E9QE09	0.941	0.979	3.030E-65	364	0.673	0.701	E9QE09.pdb.gz	E9QE09_DANRE Galactose-1-phosphate uridylyltransferase OS=Danio rerio OX=7955 GN=zgc:158795 PE=1 SV=1
5	AFDB:Q9VMA2	0.901	0.975	1.838E-55	350	0.525	0.569	Q9VMA2.pdb.gz	GALT_DROME Probable galactose-1-phosphate uridylyltransferase OS=Drosophila melanogaster OX=7227 GN=Galt PE=2 SV=2
6	AFDB:P09148	0.896	0.975	7.584E-53	348	0.509	0.555	P09148.pdb.gz	GAL7_ECOLI Galactose-1-phosphate uridylyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=galT PE=1 SV=2
7	PDB:1gupA	0.898	0.980	4.190E-52	347	0.509	0.556	1gupA.pdb.gz	Structural analysis of the H166G site-directed mutant of galactose-1-phosphate uridylyltransferase complexed with either UDP-glucose or UDP-galactose: detailed description of the nucleotide sugar binding site.
8	AFDB:A0A1D8PCM2	0.896	0.880	1.150E-47	386	0.433	0.425	A0A1D8PCM2.pdb.gz	A0A1D8PCM2_CANAL Galactose-1-phosphate uridylyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAL7 PE=3 SV=1
9	AFDB:P08431	0.892	0.923	4.615E-47	366	0.427	0.443	P08431.pdb.gz	GAL7_YEAST Galactose-1-phosphate uridylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAL7 PE=1 SV=4
10	AFDB:Q9HDU5	0.883	0.906	9.245E-47	369	0.427	0.439	Q9HDU5.pdb.gz	GAL7_SCHPO Galactose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gal7 PE=3 SV=1
11	AFDB:A0A0S2Z4I0	0.446	0.847	4.422E-29	193	0.446	0.876	A0A0S2Z4I0.pdb.gz	A0A0S2Z4I0_HUMAN Galactose-1-phosphate uridylyltransferase isoform 2 OS=Homo sapiens OX=9606 GN=GALT PE=1 SV=1
12	AFDB:Q9FK51	0.726	0.779	1.006E-23	351	0.201	0.217	Q9FK51.pdb.gz	AGLUP_ARATH ADP-glucose phosphorylase OS=Arabidopsis thaliana OX=3702 GN=At5g18200 PE=1 SV=1
13	PDB:2h39B	0.697	0.836	1.128E-21	313	0.172	0.208	2h39B.pdb.gz	Structure and Mechanism of an ADP-Glucose Phosphorylase from Arabidopsis thaliana
14	PDB:2fitA	0.230	0.578	2.508E-5	130	0.069	0.200	2fitA.pdb.gz	MAD analysis of FHIT, a putative human tumor suppressor from the HIT protein family.
15	PDB:3anoB	0.258	0.504	3.761E-5	175	0.063	0.137	3anoB.pdb.gz	Structural insights into the novel diadenosine 5',5-P1,P4-tetraphosphate phosphorylase from Mycobacterium tuberculosis H37Rv
16	PDB:1emsA	0.238	0.221	7.111E-5	412	0.087	0.080	1emsA.pdb.gz
17	PDB:3anoA	0.232	0.505	9.499E-5	158	0.061	0.146	3anoA.pdb.gz	Structural insights into the novel diadenosine 5',5-P1,P4-tetraphosphate phosphorylase from Mycobacterium tuberculosis H37Rv
18	PDB:4i5tA	0.304	0.362	1.067E-4	306	0.119	0.147	4i5tA.pdb.gz
19	PDB:7p8pB	0.233	0.533	1.130E-4	147	0.098	0.252	7p8pB.pdb.gz	Chemical Proteomics of the Tumor Suppressor Fhit Covalently Bound to the Cofactor Ap 3 A Elucidates Its Inhibitory Action on Translation.
20	PDB:6g9zA	0.187	0.503	2.296E-3	121	0.045	0.140	6g9zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QE09	0.0	558	364	0.673	0.701	E9QE09_DANRE Galactose-1-phosphate uridylyltransferase OS=Danio rerio OX=7955 GN=zgc:158795 PE=1 SV=1
2	P07902	0.0	787	379	1.000	1.000	GALT_HUMAN Galactose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=GALT PE=1 SV=3
3	P43424	0.0	711	379	0.889	0.889	GALT_RAT Galactose-1-phosphate uridylyltransferase OS=Rattus norvegicus OX=10116 GN=Galt PE=2 SV=1
4	Q03249	0.0	725	379	0.910	0.910	GALT_MOUSE Galactose-1-phosphate uridylyltransferase OS=Mus musculus OX=10090 GN=Galt PE=1 SV=3
5	Q9VMA2	1.47e-145	418	350	0.528	0.571	GALT_DROME Probable galactose-1-phosphate uridylyltransferase OS=Drosophila melanogaster OX=7227 GN=Galt PE=2 SV=2
6	P09148	2.40e-144	415	348	0.512	0.557	GAL7_ECOLI Galactose-1-phosphate uridylyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=galT PE=1 SV=2
7	A0A0S2Z4I0	2.73e-122	353	193	0.446	0.876	A0A0S2Z4I0_HUMAN Galactose-1-phosphate uridylyltransferase isoform 2 OS=Homo sapiens OX=9606 GN=GALT PE=1 SV=1
8	P08431	3.56e-112	333	366	0.435	0.451	GAL7_YEAST Galactose-1-phosphate uridylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAL7 PE=1 SV=4
9	A0A1D8PCM2	8.59e-109	326	386	0.438	0.430	A0A1D8PCM2_CANAL Galactose-1-phosphate uridylyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAL7 PE=3 SV=1
10	Q9HDU5	8.02e-108	323	369	0.422	0.434	GAL7_SCHPO Galactose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gal7 PE=3 SV=1
11	Q9FK51	8.07e-14	74.3	351	0.195	0.211	AGLUP_ARATH ADP-glucose phosphorylase OS=Arabidopsis thaliana OX=3702 GN=At5g18200 PE=1 SV=1
12	P49776	0.007	39.7	182	0.069	0.143	APH1_SCHPO Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aph1 PE=1 SV=2
13	O76463	0.52	34.7	440	0.069	0.059	NFT1_CAEEL Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans OX=6239 GN=nft-1 PE=1 SV=1
14	Q10714	0.82	34.3	615	0.063	0.039	ACE_DROME Angiotensin-converting enzyme OS=Drosophila melanogaster OX=7227 GN=Ance PE=1 SV=3
15	Q681K7	1.5	33.5	593	0.074	0.047	GEX1_ARATH Protein GAMETE EXPRESSED 1 OS=Arabidopsis thaliana OX=3702 GN=GEX1 PE=1 SV=1
16	Q38AK4	3.1	32.3	365	0.045	0.047	Q38AK4_TRYB2 Centrosomal protein POC5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3050 PE=3 SV=1
17	P9WI61	7.6	31.2	789	0.063	0.030	PLSB_MYCTU Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=plsB PE=1 SV=1
18	E9Q7N9	8.7	31.2	4488	0.055	0.005	E9Q7N9_MOUSE Dynein, axonemal, heavy chain 11 OS=Mus musculus OX=10090 GN=Dnah11 PE=1 SV=2
19	Q9QZH1	8.7	31.2	4488	0.055	0.005	Q9QZH1_MOUSE Left-right dynein OS=Mus musculus OX=10090 GN=Dnah11 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01087 GalP_UDP_transf	2.4e-61	218.9	Galactose-1-phosphate uridyl transferase, N-terminal domain
2	PF02744 GalP_UDP_tr_C	1.6e-65	231.4	Galactose-1-phosphate uridyl transferase, C-terminal domain
3	PF01230 HIT	1.8	20.6	HIT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368119

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000465930	0.999	Galactokinase
2	9606.ENSP00000483375	0.999	UDP-glucose 4-epimerase
3	9606.ENSP00000338703	0.994	UTP--glucose-1-phosphate uridylyltransferase
4	9606.ENSP00000360124	0.965	Phosphoglucomutase-1
5	9606.ENSP00000453129	0.952	N-acetylgalactosamine kinase
6	9606.ENSP00000369055	0.932	Beta-1,4-galactosyltransferase 1
7	9606.ENSP00000319501	0.929	UDP-glucose 6-dehydrogenase
8	9606.ENSP00000371393	0.923	Phosphoglucomutase-2
9	9606.ENSP00000301046	0.922	Alpha-lactalbumin
10	9606.ENSP00000310696	0.919	Beta-1,4-galactosyltransferase 2
11	9606.ENSP00000272252	0.858	Aldose 1-epimerase
12	9606.ENSP00000450565	0.817	Interleukin-11 receptor subunit alpha
13	9606.ENSP00000354238	0.800	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
14	9606.ENSP00000406261	0.800	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
15	9606.ENSP00000356825	0.646	Adenylate cyclase type 10
16	9606.ENSP00000362271	0.591	Adenylate kinase isoenzyme 1
17	9606.ENSP00000371230	0.585	GTP:AMP phosphotransferase AK3, mitochondrial
18	9606.ENSP00000261296	0.581	dTDP-D-glucose 4,6-dehydratase
19	9606.ENSP00000283148	0.569	UDP-glucuronic acid decarboxylase 1
20	9606.ENSP00000381461	0.565	Protein phosphatase methylesterase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008108	0.999	UDP-glucose:hexose-1-phosphate uridylyltransferase activity
GO:0005488	0.998	binding
GO:0005515	0.956	protein binding
GO:0043167	0.793	ion binding
GO:0046872	0.715	metal ion binding
GO:0008270	0.685	zinc ion binding
GO:0036094	0.365	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0006807	0.998	nitrogen compound metabolic process
GO:0006012	0.998	galactose metabolic process
GO:0044282	0.994	small molecule catabolic process
GO:1901135	0.992	carbohydrate derivative metabolic process
GO:0055086	0.990	nucleobase-containing small molecule metabolic process
GO:1901575	0.984	organic substance catabolic process
GO:0006793	0.950	phosphorus metabolic process
GO:0016052	0.947	carbohydrate catabolic process
GO:0046365	0.917	monosaccharide catabolic process
GO:0009225	0.882	nucleotide-sugar metabolic process
GO:0019320	0.870	hexose catabolic process
GO:1901564	0.399	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0012505	0.995	endomembrane system
GO:0005794	0.891	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13989	0.999	alpha-D-galactose 1-phosphate + UDP-alpha-D-glucose = alpha-D-glucose 1-phosphate + UDP-alpha-D-galactose
EC:2.7.7.12	0.999	UDP-glucose--hexose-1-phosphate uridylyltransferase.

[back to server]