StarFunc result for job id P07919

User Input

>input (91 residues)
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSR
SHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07919	1.000	1.000	6.232E-13	91	1.000	1.000	P07919.pdb.gz	QCR6_HUMAN Cytochrome b-c1 complex subunit 6, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRH PE=1 SV=2
2	AFDB:Q5M9I5	0.778	0.795	1.496E-10	89	0.879	0.899	Q5M9I5.pdb.gz	QCR6_RAT Cytochrome b-c1 complex subunit 6, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrh PE=3 SV=1
3	AFDB:P00127	0.638	0.404	2.199E-3	147	0.352	0.218	P00127.pdb.gz	QCR6_YEAST Cytochrome b-c1 complex subunit 6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QCR6 PE=1 SV=2
4	AFDB:O42932	0.677	0.310	4.942E-3	214	0.341	0.145	O42932.pdb.gz	QCR6_SCHPO Cytochrome b-c1 complex subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr6 PE=3 SV=1
5	PDB:6giqQ	0.667	0.799	1.760E-2	75	0.264	0.320	6giqQ.pdb.gz	Cryo-EM structure of the yeast respiratory supercomplex.
6	AFDB:F4HXY8	0.599	0.343	7.193E-2	166	0.198	0.108	F4HXY8.pdb.gz	F4HXY8_ARATH Ubiquinol-cytochrome C reductase hinge protein OS=Arabidopsis thaliana OX=3702 GN=At1g15120 PE=1 SV=1
7	AFDB:Q9SJV7	0.579	0.821	8.670E-2	62	0.220	0.323	Q9SJV7.pdb.gz	QCR62_ARATH Cytochrome b-c1 complex subunit 6-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=QCR6-2 PE=1 SV=1
8	AFDB:Q57YU5	0.629	0.783	4.659E-1	71	0.220	0.282	Q57YU5.pdb.gz	Q57YU5_TRYB2 Mitochondrial hinge protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.130 PE=3 SV=1
9	PDB:6ta5D	0.425	0.130	1.766	345	0.055	0.014	6ta5D.pdb.gz
10	PDB:1h7cA	0.308	0.283	2.265	103	0.099	0.087	1h7cA.pdb.gz
11	AFDB:G3XD21	0.418	0.111	3.638	396	0.143	0.033	G3XD21.pdb.gz	G3XD21_PSEAE Resistance-Nodulation-Cell Division (RND) multidrug efflux membrane fusion protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA2019 PE=3 SV=1
12	PDB:5ng5A	0.409	0.126	3.728	340	0.066	0.018	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
13	PDB:7tveG	0.255	0.112	3.728	307	0.099	0.029	7tveG.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
14	AFDB:Q8C0D7	0.272	0.132	3.872	249	0.099	0.036	Q8C0D7.pdb.gz	ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus OX=10090 GN=Ing4 PE=1 SV=2
15	AFDB:Q0JEE2	0.418	0.136	4.385	326	0.077	0.021	Q0JEE2.pdb.gz	WRK51_ORYSJ WRKY transcription factor WRKY51 OS=Oryza sativa subsp. japonica OX=39947 GN=WRKY51 PE=1 SV=1
16	PDB:2q9cA	0.199	0.069	5.090	304	0.077	0.023	2q9cA.pdb.gz	X-ray Structures of the Signal Recognition Particle Receptor Reveal Targeting Cycle Intermediates.
17	PDB:1u2mC	0.277	0.205	6.135	143	0.099	0.063	1u2mC.pdb.gz
18	PDB:3rx6A	0.244	0.153	6.135	187	0.066	0.032	3rx6A.pdb.gz
19	PDB:7b93p	0.384	0.218	6.530	171	0.121	0.064	7b93p.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
20	PDB:7d5sA5	0.324	0.075	6.530	514	0.110	0.019	7d5sA5.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07919	2.18e-59	178	91	1.000	1.000	QCR6_HUMAN Cytochrome b-c1 complex subunit 6, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRH PE=1 SV=2
2	P99028	1.88e-47	147	89	0.901	0.921	QCR6_MOUSE Cytochrome b-c1 complex subunit 6, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrh PE=1 SV=2
3	Q5M9I5	9.76e-46	143	89	0.879	0.899	QCR6_RAT Cytochrome b-c1 complex subunit 6, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrh PE=3 SV=1
4	Q9SJV7	0.002	35.4	62	0.220	0.323	QCR62_ARATH Cytochrome b-c1 complex subunit 6-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=QCR6-2 PE=1 SV=1
5	O42932	0.006	35.8	214	0.231	0.098	QCR6_SCHPO Cytochrome b-c1 complex subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr6 PE=3 SV=1
6	F4HXY8	0.010	35.4	166	0.198	0.108	F4HXY8_ARATH Ubiquinol-cytochrome C reductase hinge protein OS=Arabidopsis thaliana OX=3702 GN=At1g15120 PE=1 SV=1
7	Q8N8B7	0.86	30.0	351	0.132	0.034	TEANC_HUMAN Transcription elongation factor A N-terminal and central domain-containing protein OS=Homo sapiens OX=9606 GN=TCEANC PE=1 SV=2
8	Q9ER60	1.2	29.6	1841	0.209	0.010	SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus OX=10090 GN=Scn4a PE=1 SV=1
9	P00127	1.4	29.3	147	0.308	0.190	QCR6_YEAST Cytochrome b-c1 complex subunit 6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QCR6 PE=1 SV=2
10	P15390	1.4	29.6	1840	0.209	0.010	SCN4A_RAT Sodium channel protein type 4 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn4a PE=1 SV=1
11	F6PCK0	1.9	29.3	349	0.253	0.066	F6PCK0_DANRE HCLS1-binding protein 3 OS=Danio rerio OX=7955 GN=si:ch1073-80i24.2 PE=4 SV=1
12	Q5B430	1.9	29.3	649	0.198	0.028	BTGC_EMENI Glucan endo-1,3-beta-glucosidase btgC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=btgC PE=2 SV=1
13	Q9Y6H3	1.9	28.9	246	0.165	0.061	ATP23_HUMAN Mitochondrial inner membrane protease ATP23 homolog OS=Homo sapiens OX=9606 GN=ATP23 PE=1 SV=3
14	Q6DHB3	2.0	28.9	365	0.253	0.063	Q6DHB3_DANRE LOC553223 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC553223 PE=2 SV=1
15	O35674	3.1	28.5	920	0.187	0.018	ADA19_MOUSE Disintegrin and metalloproteinase domain-containing protein 19 OS=Mus musculus OX=10090 GN=Adam19 PE=2 SV=2
16	Q26798	4.9	28.1	512	0.110	0.020	Q26798_9TRYP Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase TbPK4 OS=Trypanosoma brucei OX=5691 PE=2 SV=2
17	Q38CK3	4.9	28.1	512	0.110	0.020	Q38CK3_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0230 PE=4 SV=1
18	Q57YU5	5.7	26.6	71	0.165	0.211	Q57YU5_TRYB2 Mitochondrial hinge protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.130 PE=3 SV=1
19	Q96EK2	6.5	27.7	531	0.143	0.024	PF21B_HUMAN PHD finger protein 21B OS=Homo sapiens OX=9606 GN=PHF21B PE=1 SV=1
20	Q9S845	7.1	27.3	372	0.110	0.027	GONS3_ARATH GDP-mannose transporter GONST3 OS=Arabidopsis thaliana OX=3702 GN=GONST3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09177 Syntaxin-6_N	3.9e+02	12.9	Syntaxin 6, N-terminal
2	PF02320 UCR_hinge	6.1e-20	82.5	Ubiquinol-cytochrome C reductase hinge protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000203407	0.999	Cytochrome b-c1 complex subunit 1, mitochondrial
2	9606.ENSP00000268379	0.999	Cytochrome b-c1 complex subunit 2, mitochondrial
3	9606.ENSP00000306397	0.999	Cytochrome b-c1 complex subunit Rieske, mitochondrial
4	9606.ENSP00000317159	0.999	Cytochrome c1, heme protein, mitochondrial
5	9606.ENSP00000332887	0.999	Cytochrome b-c1 complex subunit 9
6	9606.ENSP00000367939	0.999	Cytochrome b-c1 complex subunit 8
7	9606.ENSP00000430494	0.999	Cytochrome b-c1 complex subunit 7
8	9606.ENSP00000215565	0.997	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
9	9606.ENSP00000307786	0.997	Cytochrome c
10	9606.ENSP00000317780	0.997	Cytochrome c oxidase subunit 5A, mitochondrial
11	9606.ENSP00000354554	0.997	Cytochrome b
12	9606.ENSP00000362060	0.997	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
13	9606.ENSP00000467262	0.997	Cytochrome b-c1 complex subunit 10
14	9606.ENSP00000425759	0.994	Cytochrome c oxidase subunit 7C, mitochondrial
15	9606.ENSP00000252102	0.993	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
16	9606.ENSP00000274137	0.993	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
17	9606.ENSP00000296684	0.992	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
18	9606.ENSP00000259037	0.990	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
19	9606.ENSP00000417142	0.986	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
20	9606.ENSP00000330737	0.983	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008121	0.996	ubiquinol-cytochrome-c reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0006119	0.981	oxidative phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.999	catalytic complex
GO:0098800	0.996	inner mitochondrial membrane protein complex
GO:1990204	0.993	oxidoreductase complex
GO:1902495	0.993	transmembrane transporter complex
GO:0005746	0.993	mitochondrial respirasome
GO:0098803	0.992	respiratory chain complex
GO:0070069	0.944	cytochrome complex
GO:0005750	0.868	mitochondrial respiratory chain complex III

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11484	0.996	a quinol + 2 Fe(III)-[cytochrome c](out) = a quinone + 2 Fe(II)-[cytochrome c](out) + 2 H(+)(out)
EC:7.1.1.8	0.996	quinol--cytochrome-c reductase.

[back to server]