StarFunc result for job id P07942

User Input

>input (1786 residues)
MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGG
VCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTG
LIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCY
CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQC
NEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPG
SRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGG
SGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQC
HCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDA
LQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTG
CDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRF
LEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDV
TEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDE
LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNA
WQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEEL
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
LQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK
QSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
KDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IDN1	0.276	0.276	0.000	1785	0.666	0.667	A0A0R4IDN1.pdb.gz
2	AFDB:B7ZDA6	0.358	0.359	0.000	1782	0.564	0.566	B7ZDA6.pdb.gz	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
3	AFDB:D3ZQN7	0.529	0.529	0.000	1786	0.926	0.926	D3ZQN7.pdb.gz	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
4	AFDB:O44565	0.290	0.290	0.000	1790	0.402	0.401	O44565.pdb.gz	O44565_CAEEL Laminin subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=lam-1 PE=1 SV=3
5	AFDB:P11046	0.245	0.245	0.000	1788	0.405	0.405	P11046.pdb.gz	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
6	AFDB:P55268	0.238	0.237	0.000	1798	0.499	0.496	P55268.pdb.gz	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
7	AFDB:Q61292	0.261	0.259	0.000	1799	0.504	0.500	Q61292.pdb.gz	LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=10090 GN=Lamb2 PE=1 SV=2
8	AFDB:P15215	0.191	0.206	5.163E-86	1639	0.240	0.262	P15215.pdb.gz	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
9	AFDB:Q1LVF0	0.194	0.215	7.442E-84	1593	0.235	0.263	Q1LVF0.pdb.gz	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
10	AFDB:F1QPJ1	0.174	0.189	4.644E-82	1643	0.234	0.254	F1QPJ1.pdb.gz	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
11	PDB:4bxsV	0.066	0.092	6.952E-4	1262	0.028	0.040	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
12	PDB:2waaA	0.050	0.219	1.303E-3	335	0.011	0.057	2waaA.pdb.gz
13	PDB:8a3tA	0.057	0.399	1.446E-3	219	0.010	0.082	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
14	PDB:7qe7L	0.055	0.446	2.572E-3	183	0.008	0.082	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:4g1eB	0.043	0.091	2.855E-3	709	0.030	0.075	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
16	PDB:7l2zF	0.047	0.105	2.855E-3	664	0.038	0.102	7l2zF.pdb.gz
17	PDB:7ufgA	0.053	0.075	2.855E-3	1151	0.050	0.078	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:4uybA	0.051	0.197	3.520E-3	401	0.008	0.035	4uybA.pdb.gz
19	PDB:3wsoA	0.056	0.262	4.818E-3	252	0.008	0.056	3wsoA.pdb.gz
20	PDB:1olmE	0.048	0.187	6.259E-3	397	0.008	0.035	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQ25	0.0	3437	1834	0.926	0.902	A0A8I5ZQ25_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
2	A0A8I5ZVQ5	0.0	3258	1741	0.875	0.898	A0A8I5ZVQ5_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
3	A0A8I6A3T2	0.0	3420	1792	0.922	0.919	A0A8I6A3T2_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
4	B7ZDA6	0.0	2146	1782	0.568	0.569	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
5	D3ZQN7	0.0	3438	1786	0.926	0.926	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
6	F1MNT4	0.0	3486	1786	0.938	0.938	F1MNT4_BOVIN Laminin subunit beta 1 OS=Bos taurus OX=9913 GN=LAMB1 PE=4 SV=3
7	O44565	0.0	1343	1790	0.409	0.408	O44565_CAEEL Laminin subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=lam-1 PE=1 SV=3
8	P02469	0.0	3444	1786	0.928	0.928	LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus OX=10090 GN=Lamb1 PE=1 SV=3
9	P07942	0.0	3705	1786	1.000	1.000	LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2
10	P11046	0.0	1375	1788	0.408	0.408	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
11	P55268	0.0	1878	1798	0.500	0.497	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
12	Q01635	0.0	608	303	0.155	0.914	LAMB1_CHICK Laminin subunit beta-1 (Fragment) OS=Gallus gallus OX=9031 GN=LAMB1 PE=1 SV=1
13	Q61292	0.0	1900	1799	0.507	0.504	LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=10090 GN=Lamb2 PE=1 SV=2
14	Q8JHV7	0.0	2533	1785	0.670	0.671	Q8JHV7_DANRE Laminin beta 1 OS=Danio rerio OX=7955 GN=lamb1 PE=1 SV=1
15	F1LPI5	1.21e-121	416	1172	0.128	0.195	F1LPI5_RAT Laminin subunit beta 3 OS=Rattus norvegicus OX=10116 GN=Lamb3 PE=4 SV=2
16	Q61087	2.20e-121	415	1168	0.125	0.191	LAMB3_MOUSE Laminin subunit beta-3 OS=Mus musculus OX=10090 GN=Lamb3 PE=1 SV=2
17	Q13751	6.32e-119	408	1172	0.124	0.189	LAMB3_HUMAN Laminin subunit beta-3 OS=Homo sapiens OX=9606 GN=LAMB3 PE=1 SV=1
18	P19137	8.55e-109	389	3083	0.200	0.116	LAMA1_MOUSE Laminin subunit alpha-1 OS=Mus musculus OX=10090 GN=Lama1 PE=1 SV=2
19	G5ECE3	4.48e-104	374	3102	0.184	0.106	LAM3_CAEEL Laminin subunit alpha lam-3 OS=Caenorhabditis elegans OX=6239 GN=lam-3 PE=1 SV=1
20	Q9JI33	5.33e-104	349	628	0.110	0.314	NET4_MOUSE Netrin-4 OS=Mus musculus OX=10090 GN=Ntn4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04108 ATG17_like	1.1e+02	13.7	Autophagy protein ATG17-like domain
2	PF01544 CorA	13	16.6	CorA-like Mg2+ transporter protein
3	PF00754 F5_F8_type_C	26	16.4	F5/8 type C domain
4	PF00053 Laminin_EGF	5.7e-114	383.5	Laminin EGF domain
5	PF00055 Laminin_N	3.6e-77	270.6	Laminin N-terminal (Domain VI)
6	PF20155 TMP_3	41	15.4	Tape measure protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222399

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258341	0.999	Laminin subunit gamma-1
2	9606.ENSP00000252999	0.996	Laminin subunit alpha-5
3	9606.ENSP00000354360	0.988	Laminin subunit gamma-3
4	9606.ENSP00000324532	0.984	Laminin subunit alpha-3
5	9606.ENSP00000379350	0.961	Integrin beta-1
6	9606.ENSP00000452120	0.961	Integrin alpha-7
7	9606.ENSP00000442600	0.958	Dystroglycan
8	9606.ENSP00000200181	0.957	Integrin beta-4
9	9606.ENSP00000230538	0.957	Laminin subunit alpha-4
10	9606.ENSP00000007722	0.954	Integrin alpha-3
11	9606.ENSP00000374309	0.953	Laminin subunit alpha-1
12	9606.ENSP00000386896	0.953	Integrin alpha-6
13	9606.ENSP00000400365	0.950	Laminin subunit alpha-2
14	9606.ENSP00000264144	0.949	Laminin subunit gamma-2
15	9606.ENSP00000261023	0.947	Integrin alpha-V
16	9606.ENSP00000296585	0.944	Integrin alpha-2
17	9606.ENSP00000452786	0.943	Integrin beta-3
18	9606.ENSP00000282588	0.940	Integrin alpha-1
19	9606.ENSP00000275493	0.932	Epidermal growth factor receptor
20	9606.ENSP00000340937	0.931	Collagen alpha-1(XVII) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	0.999	extracellular matrix structural constituent
GO:0044877	0.890	protein-containing complex binding
GO:0050839	0.387	cell adhesion molecule binding
GO:0042802	0.382	identical protein binding
GO:0005102	0.375	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.993	multicellular organismal process
GO:0048856	0.992	anatomical structure development
GO:0009987	0.991	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0007275	0.974	multicellular organism development
GO:0048518	0.952	positive regulation of biological process
GO:0016043	0.925	cellular component organization
GO:0048870	0.924	cell motility
GO:0009653	0.896	anatomical structure morphogenesis
GO:0031589	0.889	cell-substrate adhesion
GO:0007492	0.883	endoderm development
GO:0048731	0.865	system development
GO:0048513	0.856	animal organ development
GO:0048869	0.848	cellular developmental process
GO:0040012	0.836	regulation of locomotion
GO:0030154	0.834	cell differentiation
GO:0030334	0.829	regulation of cell migration
GO:0016477	0.824	cell migration
GO:0007369	0.815	gastrulation
GO:0042127	0.809	regulation of cell population proliferation
GO:0048522	0.793	positive regulation of cellular process
GO:0034446	0.773	substrate adhesion-dependent cell spreading
GO:0007399	0.766	nervous system development
GO:0050896	0.728	response to stimulus
GO:0048519	0.574	negative regulation of biological process
GO:0031175	0.565	neuron projection development
GO:0048523	0.546	negative regulation of cellular process
GO:0021885	0.449	forebrain cell migration
GO:0009887	0.441	animal organ morphogenesis
GO:0001704	0.414	formation of primary germ layer
GO:0035987	0.384	endodermal cell differentiation
GO:0042063	0.368	gliogenesis
GO:0051716	0.336	cellular response to stimulus
GO:0008284	0.316	positive regulation of cell population proliferation
GO:0040017	0.308	positive regulation of locomotion
GO:0007154	0.306	cell communication
GO:0023052	0.303	signaling
GO:0050678	0.302	regulation of epithelial cell proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0005576	0.992	extracellular region
GO:0005737	0.864	cytoplasm
GO:0043227	0.858	membrane-bounded organelle
GO:0005886	0.823	plasma membrane
GO:0043231	0.806	intracellular membrane-bounded organelle
GO:0032991	0.729	protein-containing complex
GO:0005604	0.433	basement membrane
GO:0012505	0.364	endomembrane system
GO:0031982	0.336	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]