StarFunc result for job id P07947

User Input

>input (543 residues)
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT
PFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQI
INNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRG
IFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY
TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFL
KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNRE
VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPG
ENL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1JPZ3	0.831	0.845	9.414E-83	534	0.726	0.738	Q1JPZ3.pdb.gz	SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio OX=7955 GN=src PE=1 SV=2
2	AFDB:F1RDG9	0.853	0.852	1.731E-80	544	0.729	0.728	F1RDG9.pdb.gz	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
3	AFDB:A5WWJ6	0.847	0.871	1.056E-79	528	0.731	0.752	A5WWJ6.pdb.gz
4	AFDB:F1NQU9	0.836	0.850	1.511E-78	534	0.737	0.749	F1NQU9.pdb.gz	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
5	AFDB:P09769	0.850	0.873	1.250E-76	529	0.680	0.698	P09769.pdb.gz	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
6	AFDB:P14234	0.832	0.873	3.570E-75	517	0.672	0.706	P14234.pdb.gz	FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus OX=10090 GN=Fgr PE=1 SV=2
7	PDB:2h8hA	0.805	0.980	2.051E-72	445	0.689	0.840	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
8	AFDB:P08103	0.810	0.838	5.480E-68	524	0.569	0.590	P08103.pdb.gz	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
9	AFDB:J3KPD6	0.795	0.820	8.846E-68	526	0.582	0.601	J3KPD6.pdb.gz	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
10	AFDB:P07948	0.809	0.856	7.836E-67	512	0.543	0.576	P07948.pdb.gz	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
11	AFDB:Q9V9J3	0.799	0.839	2.769E-65	517	0.529	0.555	Q9V9J3.pdb.gz	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
12	PDB:1k9aB	0.460	0.559	9.590E-36	441	0.311	0.383	1k9aB.pdb.gz
13	PDB:4fl2A	0.460	0.450	1.274E-29	555	0.245	0.240	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.441	0.435	2.433E-26	551	0.239	0.236	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:7mfdA	0.417	0.542	1.789E-16	410	0.182	0.241	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
16	PDB:6s73A	0.427	0.825	5.468E-16	269	0.127	0.257	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:8dksA	0.377	0.687	5.108E-15	283	0.147	0.283	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
18	PDB:4krcA	0.390	0.684	5.682E-15	297	0.129	0.236	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
19	PDB:5ufuA	0.402	0.574	9.673E-15	369	0.145	0.214	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:4btfA	0.400	0.515	1.832E-14	413	0.120	0.157	4btfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1A5H8	975	546	0.864	0.859	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
2	E1BIM8	834	688	0.716	0.565	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
3	F1LM93	1060	541	0.956	0.959	YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus OX=10116 GN=Yes1 PE=1 SV=1
4	F1NQU9	825	534	0.744	0.757	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
5	F1RDG9	801	544	0.729	0.728	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
6	H0Y3C5	629	525	0.549	0.568	H0Y3C5_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
7	J3KPD6	629	526	0.549	0.567	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
8	J3QRU1	1134	548	1.000	0.991	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
9	P00523	839	533	0.744	0.758	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
10	P05480	833	535	0.744	0.755	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
11	P06239	590	509	0.510	0.544	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
12	P06240	587	509	0.510	0.544	LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus OX=10090 GN=Lck PE=1 SV=4
13	P06241	805	537	0.735	0.743	FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3
14	P07947	1134	543	1.000	1.000	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
15	P07948	593	512	0.510	0.541	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
16	P08103	622	524	0.549	0.569	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
17	P08631	629	526	0.549	0.567	HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=5
18	P09324	1053	541	0.919	0.922	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
19	P09769	762	529	0.670	0.688	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
20	P12931	833	536	0.716	0.726	SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1e+02	13.4	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	24	15.3	Haspin like kinase domain
3	PF00069 Pkinase	4e-41	152.7	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	1.4e-88	308.1	Protein tyrosine and serine/threonine kinase
5	PF00017 SH2	1.3e-24	97.4	SH2 domain
6	PF00018 SH3_1	2.4e-15	67.2	SH3 domain
7	PF17902 SH3_10	21	16.6	SH3 domain
8	PF07653 SH3_2	1.7e-07	42.3	Variant SH3 domain
9	PF08239 SH3_3	3.6e+02	13.0	Bacterial SH3 domain
10	PF14604 SH3_9	1e-08	46.3	Variant SH3 domain
11	PF17978 zf-RING_14	1.3e+02	14.4	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000462468

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346671	0.994	Tyrosine-protein kinase Fyn
2	9606.ENSP00000341189	0.986	Focal adhesion kinase 1
3	9606.ENSP00000362680	0.979	Proto-oncogene tyrosine-protein kinase Src
4	9606.ENSP00000275493	0.976	Epidermal growth factor receptor
5	9606.ENSP00000457421	0.957	Platelet endothelial cell adhesion molecule
6	9606.ENSP00000267257	0.954	Paxillin
7	9606.ENSP00000264033	0.951	E3 ubiquitin-protein ligase CBL
8	9606.ENSP00000383118	0.951	Cell division control protein 42 homolog
9	9606.ENSP00000391669	0.951	Breast cancer anti-estrogen resistance protein 1
10	9606.ENSP00000400175	0.947	Transforming protein RhoA
11	9606.ENSP00000376345	0.946	Growth factor receptor-bound protein 2
12	9606.ENSP00000363117	0.945	Tyrosine-protein kinase Fgr
13	9606.ENSP00000269571	0.943	Receptor tyrosine-protein kinase erbB-2
14	9606.ENSP00000300574	0.943	Adapter molecule crk
15	9606.ENSP00000267101	0.941	Receptor tyrosine-protein kinase erbB-3
16	9606.ENSP00000342235	0.940	Receptor tyrosine-protein kinase erbB-4
17	9606.ENSP00000211998	0.939	Vinculin
18	9606.ENSP00000185206	0.938	Chloride intracellular channel protein 5
19	9606.ENSP00000233668	0.938	Docking protein 1
20	9606.ENSP00000387784	0.938	Son of sevenless homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0019899	0.918	enzyme binding
GO:0005102	0.879	signaling receptor binding
GO:0051219	0.755	phosphoprotein binding
GO:0004715	0.693	non-membrane spanning protein tyrosine kinase activity
GO:0045309	0.627	protein phosphorylated amino acid binding
GO:0044877	0.574	protein-containing complex binding
GO:0019900	0.572	kinase binding
GO:0001784	0.529	phosphotyrosine residue binding
GO:0019901	0.451	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0051716	0.979	cellular response to stimulus
GO:0071704	0.968	organic substance metabolic process
GO:0048518	0.965	positive regulation of biological process
GO:0043412	0.957	macromolecule modification
GO:0019538	0.950	protein metabolic process
GO:0006793	0.923	phosphorus metabolic process
GO:0048522	0.915	positive regulation of cellular process
GO:0007154	0.900	cell communication
GO:0023052	0.894	signaling
GO:0036211	0.892	protein modification process
GO:0007165	0.876	signal transduction
GO:0016310	0.863	phosphorylation
GO:0019222	0.823	regulation of metabolic process
GO:0032501	0.753	multicellular organismal process
GO:0048583	0.750	regulation of response to stimulus
GO:0006468	0.743	protein phosphorylation
GO:0048856	0.734	anatomical structure development
GO:0060255	0.722	regulation of macromolecule metabolic process
GO:0007166	0.721	cell surface receptor signaling pathway
GO:0031323	0.666	regulation of cellular metabolic process
GO:0048519	0.599	negative regulation of biological process
GO:0051174	0.517	regulation of phosphorus metabolic process
GO:0080090	0.511	regulation of primary metabolic process
GO:0051171	0.499	regulation of nitrogen compound metabolic process
GO:0071840	0.498	cellular component organization or biogenesis
GO:0007167	0.492	enzyme-linked receptor protein signaling pathway
GO:0042221	0.480	response to chemical
GO:0002682	0.470	regulation of immune system process
GO:0051246	0.465	regulation of protein metabolic process
GO:0048523	0.464	negative regulation of cellular process
GO:0048584	0.456	positive regulation of response to stimulus
GO:0016043	0.450	cellular component organization
GO:0051239	0.444	regulation of multicellular organismal process
GO:0010604	0.441	positive regulation of macromolecule metabolic process
GO:0007169	0.441	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0065009	0.438	regulation of molecular function
GO:0002376	0.434	immune system process
GO:0031325	0.424	positive regulation of cellular metabolic process
GO:0010468	0.420	regulation of gene expression
GO:0051173	0.417	positive regulation of nitrogen compound metabolic process
GO:0050790	0.414	regulation of catalytic activity
GO:0007275	0.411	multicellular organism development
GO:0046777	0.391	protein autophosphorylation
GO:0001932	0.377	regulation of protein phosphorylation
GO:0023051	0.375	regulation of signaling
GO:0010646	0.375	regulation of cell communication
GO:0009966	0.355	regulation of signal transduction
GO:0002684	0.346	positive regulation of immune system process
GO:0051338	0.335	regulation of transferase activity
GO:0070887	0.332	cellular response to chemical stimulus
GO:0042327	0.332	positive regulation of phosphorylation
GO:0051179	0.329	localization
GO:0051247	0.323	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0043227	0.951	membrane-bounded organelle
GO:0043229	0.935	intracellular organelle
GO:0043231	0.886	intracellular membrane-bounded organelle
GO:0043228	0.377	non-membrane-bounded organelle
GO:0043232	0.372	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.693	non-specific protein-tyrosine kinase.

[back to server]