StarFunc result for job id P07948

User Input

>input (512 residues)
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07948	1.000	1.000	1.516E-96	512	1.000	1.000	P07948.pdb.gz	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
2	AFDB:Q5ZMB9	0.878	0.913	2.974E-84	492	0.842	0.876	Q5ZMB9.pdb.gz	Q5ZMB9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=LYN PE=1 SV=1
3	AFDB:Q66I04	0.877	0.880	2.945E-78	510	0.750	0.753	Q66I04.pdb.gz	Q66I04_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:92124 PE=2 SV=1
4	AFDB:P08103	0.914	0.893	1.621E-77	524	0.701	0.685	P08103.pdb.gz	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
5	AFDB:J3KPD6	0.866	0.843	2.094E-76	526	0.705	0.686	J3KPD6.pdb.gz	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
6	AFDB:P06239	0.861	0.866	9.122E-74	509	0.637	0.640	P06239.pdb.gz	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
7	AFDB:P51451	0.856	0.868	6.419E-71	505	0.613	0.622	P51451.pdb.gz	BLK_HUMAN Tyrosine-protein kinase Blk OS=Homo sapiens OX=9606 GN=BLK PE=1 SV=3
8	AFDB:P16277	0.858	0.879	7.454E-70	499	0.625	0.641	P16277.pdb.gz	BLK_MOUSE Tyrosine-protein kinase Blk OS=Mus musculus OX=10090 GN=Blk PE=1 SV=4
9	AFDB:P14234	0.888	0.880	3.425E-67	517	0.562	0.557	P14234.pdb.gz	FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus OX=10090 GN=Fgr PE=1 SV=2
10	AFDB:W5U6C9	0.820	0.839	4.238E-67	500	0.605	0.620	W5U6C9.pdb.gz	W5U6C9_ICTPU Tyrosine-protein kinase OS=Ictalurus punctatus OX=7998 GN=LCK PE=2 SV=1
11	PDB:2h8hA	0.826	0.946	1.121E-60	445	0.521	0.600	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.496	0.571	5.750E-38	441	0.348	0.404	1k9aB.pdb.gz
13	PDB:4fl2A	0.484	0.448	4.458E-29	555	0.254	0.234	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.482	0.450	1.410E-26	551	0.238	0.221	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.403	0.696	7.064E-17	283	0.148	0.269	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6s73A	0.444	0.817	2.051E-16	269	0.131	0.249	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:7mfdA	0.432	0.529	5.076E-16	410	0.191	0.239	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
18	PDB:4btfA	0.437	0.533	9.624E-16	413	0.137	0.169	4btfA.pdb.gz
19	PDB:4krcA	0.428	0.711	1.191E-15	297	0.135	0.232	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
20	PDB:4rerA	0.431	0.478	5.023E-15	459	0.135	0.150	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1A5H8	590	546	0.539	0.505	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
2	E1BIM8	572	688	0.523	0.390	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
3	F1LM93	591	541	0.541	0.512	YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus OX=10116 GN=Yes1 PE=1 SV=1
4	F1NQU9	575	534	0.533	0.511	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
5	F1RDG9	592	544	0.547	0.515	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
6	H0Y3C5	755	525	0.713	0.695	H0Y3C5_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
7	J3KPD6	753	526	0.711	0.692	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
8	J3QRU1	592	548	0.541	0.505	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
9	P00523	575	533	0.568	0.546	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
10	P05480	573	535	0.539	0.516	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
11	P06239	685	509	0.631	0.635	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
12	P06240	686	509	0.639	0.642	LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus OX=10090 GN=Lck PE=1 SV=4
13	P06241	590	537	0.549	0.523	FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3
14	P07947	592	543	0.541	0.510	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
15	P07948	1066	512	1.000	1.000	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
16	P08103	759	524	0.701	0.685	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
17	P08631	754	526	0.711	0.692	HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=5
18	P09324	598	541	0.547	0.518	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
19	P09769	564	529	0.531	0.514	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
20	P12931	572	536	0.521	0.498	SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.9	17.8	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	76	13.7	Haspin like kinase domain
3	PF00069 Pkinase	8.3e-45	164.8	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	2.4e-92	320.5	Protein tyrosine and serine/threonine kinase
5	PF00017 SH2	3.4e-20	83.2	SH2 domain
6	PF00018 SH3_1	2.5e-13	60.7	SH3 domain
7	PF07653 SH3_2	0.0006	30.9	Variant SH3 domain
8	PF08239 SH3_3	89	14.9	Bacterial SH3 domain
9	PF14604 SH3_9	0.00086	30.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428924

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437940	0.999	B-lymphocyte antigen CD19
2	9606.ENSP00000221972	0.998	B-cell antigen receptor complex-associated protein alpha chain
3	9606.ENSP00000220597	0.996	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
4	9606.ENSP00000264033	0.996	E3 ubiquitin-protein ligase CBL
5	9606.ENSP00000313681	0.994	Sphingosine kinase 1
6	9606.ENSP00000391592	0.994	Tyrosine-protein phosphatase non-receptor type 6
7	9606.ENSP00000320176	0.992	Hematopoietic lineage cell-specific protein
8	9606.ENSP00000085219	0.991	B-cell receptor CD22
9	9606.ENSP00000411355	0.991	Receptor-type tyrosine-protein phosphatase C
10	9606.ENSP00000308782	0.990	Platelet glycoprotein VI
11	9606.ENSP00000354952	0.990	GRB2-associated-binding protein 2
12	9606.ENSP00000222139	0.989	Erythropoietin receptor
13	9606.ENSP00000472929	0.988	Proto-oncogene vav
14	9606.ENSP00000376544	0.986	B-cell antigen receptor complex-associated protein beta chain
15	9606.ENSP00000224337	0.984	B-cell linker protein
16	9606.ENSP00000267257	0.984	Paxillin
17	9606.ENSP00000401303	0.984	SHC-transforming protein 1
18	9606.ENSP00000391669	0.983	Breast cancer anti-estrogen resistance protein 1
19	9606.ENSP00000482457	0.983	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
20	9606.ENSP00000264657	0.982	Signal transducer and activator of transcription 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0019899	0.866	enzyme binding
GO:0004715	0.750	non-membrane spanning protein tyrosine kinase activity
GO:0005102	0.676	signaling receptor binding
GO:0051219	0.414	phosphoprotein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0051716	0.986	cellular response to stimulus
GO:0019222	0.971	regulation of metabolic process
GO:0071704	0.964	organic substance metabolic process
GO:0044237	0.958	cellular metabolic process
GO:0043412	0.944	macromolecule modification
GO:0044238	0.936	primary metabolic process
GO:0006793	0.936	phosphorus metabolic process
GO:0048522	0.935	positive regulation of cellular process
GO:0023052	0.934	signaling
GO:0042221	0.930	response to chemical
GO:0006807	0.928	nitrogen compound metabolic process
GO:0036211	0.920	protein modification process
GO:0007154	0.916	cell communication
GO:0060255	0.903	regulation of macromolecule metabolic process
GO:0048583	0.901	regulation of response to stimulus
GO:0080090	0.895	regulation of primary metabolic process
GO:0031323	0.891	regulation of cellular metabolic process
GO:0050865	0.880	regulation of cell activation
GO:0007165	0.874	signal transduction
GO:0048519	0.864	negative regulation of biological process
GO:0002429	0.864	immune response-activating cell surface receptor signaling pathway
GO:0032501	0.853	multicellular organismal process
GO:0051171	0.853	regulation of nitrogen compound metabolic process
GO:0006796	0.826	phosphate-containing compound metabolic process
GO:0051174	0.817	regulation of phosphorus metabolic process
GO:0032502	0.810	developmental process
GO:1901700	0.806	response to oxygen-containing compound
GO:0010033	0.779	response to organic substance
GO:0032101	0.779	regulation of response to external stimulus
GO:0009605	0.773	response to external stimulus
GO:0023051	0.771	regulation of signaling
GO:0051246	0.767	regulation of protein metabolic process
GO:0051179	0.751	localization
GO:0010646	0.740	regulation of cell communication
GO:0048856	0.725	anatomical structure development
GO:0032103	0.704	positive regulation of response to external stimulus
GO:0070887	0.683	cellular response to chemical stimulus
GO:0080134	0.655	regulation of response to stress
GO:0031325	0.643	positive regulation of cellular metabolic process
GO:0016310	0.641	phosphorylation
GO:0051173	0.639	positive regulation of nitrogen compound metabolic process
GO:0006468	0.625	protein phosphorylation
GO:0048523	0.614	negative regulation of cellular process
GO:0010604	0.610	positive regulation of macromolecule metabolic process
GO:0042325	0.610	regulation of phosphorylation
GO:0065009	0.596	regulation of molecular function
GO:0009966	0.593	regulation of signal transduction
GO:0006950	0.587	response to stress
GO:0010468	0.549	regulation of gene expression
GO:0051234	0.547	establishment of localization
GO:0031347	0.535	regulation of defense response
GO:0031399	0.502	regulation of protein modification process
GO:0001932	0.493	regulation of protein phosphorylation
GO:0045937	0.492	positive regulation of phosphate metabolic process
GO:0051247	0.490	positive regulation of protein metabolic process
GO:0042127	0.471	regulation of cell population proliferation
GO:0042327	0.470	positive regulation of phosphorylation
GO:0032879	0.468	regulation of localization
GO:0071310	0.459	cellular response to organic substance
GO:0051240	0.444	positive regulation of multicellular organismal process
GO:0023056	0.441	positive regulation of signaling
GO:0010647	0.441	positive regulation of cell communication
GO:0006810	0.431	transport
GO:0031401	0.368	positive regulation of protein modification process
GO:0022407	0.353	regulation of cell-cell adhesion
GO:0050867	0.351	positive regulation of cell activation
GO:0050790	0.347	regulation of catalytic activity
GO:0051249	0.345	regulation of lymphocyte activation
GO:0009967	0.335	positive regulation of signal transduction
GO:2000145	0.334	regulation of cell motility
GO:0002696	0.333	positive regulation of leukocyte activation
GO:0048870	0.330	cell motility
GO:1902531	0.327	regulation of intracellular signal transduction
GO:0007275	0.317	multicellular organism development
GO:1901701	0.317	cellular response to oxygen-containing compound
GO:0050793	0.314	regulation of developmental process
GO:0018108	0.310	peptidyl-tyrosine phosphorylation
GO:0071840	0.302	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.998	cytoplasm
GO:0043227	0.963	membrane-bounded organelle
GO:0005829	0.938	cytosol
GO:0043231	0.938	intracellular membrane-bounded organelle
GO:0005634	0.373	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.750	non-specific protein-tyrosine kinase.

[back to server]