StarFunc result for job id P07949

User Input

>input (1114 residues)
MAKATSGAAGLRLLLLLLLPLLGKVALGLYFSRDAYWEKLYVDQAAGTPLLYVHALRDAP
EEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLT
VYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENR
PPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELV
AVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTVVATLRVFD
ADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNR
NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFA
QIGKVCVENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAE
LHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGR
CEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPR
GIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHCY
HKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLK
QVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDH
PDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY
EEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERL
FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAA
STPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRA
DGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8E7C6	0.548	0.552	0.000	1106	0.590	0.594	A8E7C6.pdb.gz	A8E7C6_DANRE Proto-oncogene tyrosine-protein kinase receptor Ret OS=Danio rerio OX=7955 GN=c-ret PE=1 SV=1
2	AFDB:G3V9H8	0.689	0.688	0.000	1115	0.853	0.852	G3V9H8.pdb.gz	RET_RAT Proto-oncogene tyrosine-protein kinase receptor Ret OS=Rattus norvegicus OX=10116 GN=Ret PE=1 SV=1
3	AFDB:P07949	0.999	0.999	0.000	1114	1.000	1.000	P07949.pdb.gz	RET_HUMAN Proto-oncogene tyrosine-protein kinase receptor Ret OS=Homo sapiens OX=9606 GN=RET PE=1 SV=3
4	AFDB:Q7KA88	0.472	0.433	1.606E-81	1235	0.305	0.275	Q7KA88.pdb.gz	Q7KA88_DROME Receptor tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Ret PE=2 SV=1
5	AFDB:P11362	0.267	0.359	1.549E-47	822	0.217	0.294	P11362.pdb.gz	FGFR1_HUMAN Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3
6	AFDB:Q8JG38	0.265	0.356	9.157E-47	817	0.212	0.289	Q8JG38.pdb.gz	FGFR2_DANRE Fibroblast growth factor receptor 2 OS=Danio rerio OX=7955 GN=fgfr2 PE=1 SV=1
7	AFDB:A4JYQ2	0.261	0.360	1.627E-46	802	0.200	0.278	A4JYQ2.pdb.gz
8	AFDB:F1LSG7	0.260	0.342	2.113E-46	841	0.222	0.294	F1LSG7.pdb.gz	F1LSG7_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
9	AFDB:P35917	0.250	0.205	3.756E-46	1363	0.234	0.191	P35917.pdb.gz	VGFR3_MOUSE Vascular endothelial growth factor receptor 3 OS=Mus musculus OX=10090 GN=Flt4 PE=1 SV=1
10	AFDB:P17948	0.243	0.204	4.878E-46	1338	0.223	0.185	P17948.pdb.gz	VGFR1_HUMAN Vascular endothelial growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FLT1 PE=1 SV=2
11	PDB:1k9aB	0.215	0.531	7.021E-22	441	0.092	0.234	1k9aB.pdb.gz
12	PDB:4fl2A	0.221	0.432	3.034E-21	555	0.096	0.193	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:2h8hA	0.213	0.511	3.197E-21	445	0.094	0.236	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:4k2rA	0.214	0.422	2.206E-19	551	0.078	0.158	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:6uanB	0.194	0.745	6.912E-16	261	0.079	0.337	6uanB.pdb.gz
16	PDB:6s73A	0.210	0.805	2.300E-15	269	0.063	0.260	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:4rerA	0.205	0.473	3.316E-15	459	0.067	0.163	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:2qkwB	0.206	0.714	4.538E-15	292	0.060	0.229	2qkwB.pdb.gz
19	PDB:8dksA	0.186	0.673	5.038E-15	283	0.075	0.297	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
20	PDB:4zhxA	0.199	0.511	5.593E-15	409	0.071	0.193	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8E7C6	0.0	1318	1106	0.593	0.598	A8E7C6_DANRE Proto-oncogene tyrosine-protein kinase receptor Ret OS=Danio rerio OX=7955 GN=c-ret PE=1 SV=1
2	G3V9H8	0.0	1940	1115	0.854	0.853	RET_RAT Proto-oncogene tyrosine-protein kinase receptor Ret OS=Rattus norvegicus OX=10116 GN=Ret PE=1 SV=1
3	P07949	0.0	2311	1114	1.000	1.000	RET_HUMAN Proto-oncogene tyrosine-protein kinase receptor Ret OS=Homo sapiens OX=9606 GN=RET PE=1 SV=3
4	P35546	0.0	1857	1115	0.828	0.827	RET_MOUSE Proto-oncogene tyrosine-protein kinase receptor Ret OS=Mus musculus OX=10090 GN=Ret PE=1 SV=2
5	Q7JQD5	1.93e-127	411	817	0.219	0.299	Q7JQD5_DROME Dret protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=Ret PE=4 SV=1
6	Q9BHA9	8.11e-124	412	1235	0.219	0.198	Q9BHA9_DROME Tyrosine kinase Ret isoform 1 OS=Drosophila melanogaster OX=7227 GN=Ret PE=2 SV=1
7	Q7KT06	2.97e-123	410	1235	0.236	0.213	Q7KT06_DROME Ret oncogene, isoform A OS=Drosophila melanogaster OX=7227 GN=Ret PE=4 SV=1
8	Q7KA88	3.03e-123	410	1235	0.236	0.213	Q7KA88_DROME Receptor tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Ret PE=2 SV=1
9	F1LN06	5.84e-100	334	726	0.157	0.241	F1LN06_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
10	F1LRU8	8.20e-100	335	752	0.153	0.226	F1LRU8_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
11	P16092	1.70e-99	336	822	0.166	0.225	FGFR1_MOUSE Fibroblast growth factor receptor 1 OS=Mus musculus OX=10090 GN=Fgfr1 PE=1 SV=2
12	F1LNW0	4.75e-99	335	840	0.153	0.202	F1LNW0_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
13	F1LSG7	5.10e-99	335	841	0.153	0.202	F1LSG7_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
14	P21803	6.19e-99	334	821	0.152	0.206	FGFR2_MOUSE Fibroblast growth factor receptor 2 OS=Mus musculus OX=10090 GN=Fgfr2 PE=1 SV=4
15	Q04589	7.51e-99	334	822	0.168	0.227	FGFR1_RAT Fibroblast growth factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Fgfr1 PE=1 SV=1
16	P21802	8.47e-99	334	821	0.155	0.211	FGFR2_HUMAN Fibroblast growth factor receptor 2 OS=Homo sapiens OX=9606 GN=FGFR2 PE=1 SV=1
17	P11362	8.92e-99	334	822	0.164	0.223	FGFR1_HUMAN Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3
18	P21804	1.86e-98	333	819	0.150	0.204	FGFR1_CHICK Fibroblast growth factor receptor 1 OS=Gallus gallus OX=9031 GN=FGFR1 PE=2 SV=1
19	P22607	2.20e-98	332	806	0.151	0.208	FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
20	Q90413	1.95e-97	332	922	0.150	0.181	FGFR4_DANRE Fibroblast growth factor receptor 4 OS=Danio rerio OX=7955 GN=fgfr4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	5.2e+02	11.1	ABC1 atypical kinase-like domain
2	PF00028 Cadherin	4e-14	64.1	Cadherin domain
3	PF12330 Haspin_kinase	3e+02	11.7	Haspin like kinase domain
4	PF00069 Pkinase	4e-40	149.4	Protein kinase domain
5	PF17667 Pkinase_fungal	84	13.4	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	8.8e-98	338.3	Protein tyrosine and serine/threonine kinase
7	PF17756 RET_CLD1	9.1e-46	166.7	RET Cadherin like domain 1
8	PF17812 RET_CLD3	2.1e-44	161.8	RET Cadherin like domain 3
9	PF17813 RET_CLD4	1.2e-42	155.8	RET Cadherin like domain 4
10	PF01163 RIO1	62	14.6	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347942

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347591	0.999	GDNF family receptor alpha-1
2	9606.ENSP00000401303	0.999	SHC-transforming protein 1
3	9606.ENSP00000409007	0.999	Glial cell line-derived neurotrophic factor
4	9606.ENSP00000376345	0.997	Growth factor receptor-bound protein 2
5	9606.ENSP00000233668	0.994	Docking protein 1
6	9606.ENSP00000343636	0.992	GDNF family receptor alpha like
7	9606.ENSP00000302648	0.991	Neurturin
8	9606.ENSP00000428518	0.987	GDNF family receptor alpha-2
9	9606.ENSP00000407586	0.984	GTPase HRas
10	9606.ENSP00000387435	0.982	Artemin
11	9606.ENSP00000447241	0.982	Fibroblast growth factor receptor substrate 2
12	9606.ENSP00000274721	0.980	GDNF family receptor alpha-3
13	9606.ENSP00000403459	0.978	Growth factor receptor-bound protein 7
14	9606.ENSP00000341189	0.976	Focal adhesion kinase 1
15	9606.ENSP00000300574	0.975	Adapter molecule crk
16	9606.ENSP00000428056	0.973	Phosphatidylinositol 3-kinase regulatory subunit alpha
17	9606.ENSP00000263102	0.972	Coiled-coil domain containing 6
18	9606.ENSP00000263967	0.971	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
19	9606.ENSP00000340944	0.971	Tyrosine-protein phosphatase non-receptor type 11
20	9606.ENSP00000381793	0.971	Growth factor receptor-bound protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	0.996	protein tyrosine kinase activity
GO:0004714	0.980	transmembrane receptor protein tyrosine kinase activity
GO:0043167	0.637	ion binding
GO:0042802	0.543	identical protein binding
GO:0043169	0.397	cation binding
GO:0046872	0.382	metal ion binding
GO:0046983	0.342	protein dimerization activity
GO:0042803	0.308	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050896	0.992	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0051716	0.983	cellular response to stimulus
GO:0007154	0.979	cell communication
GO:0032501	0.965	multicellular organismal process
GO:0032502	0.956	developmental process
GO:0048856	0.951	anatomical structure development
GO:0023052	0.950	signaling
GO:0019222	0.946	regulation of metabolic process
GO:0048522	0.942	positive regulation of cellular process
GO:0007275	0.866	multicellular organism development
GO:0007165	0.859	signal transduction
GO:0048731	0.837	system development
GO:0048513	0.816	animal organ development
GO:0031323	0.799	regulation of cellular metabolic process
GO:0071840	0.791	cellular component organization or biogenesis
GO:0050793	0.780	regulation of developmental process
GO:0051239	0.777	regulation of multicellular organismal process
GO:0016043	0.772	cellular component organization
GO:0060255	0.772	regulation of macromolecule metabolic process
GO:0030154	0.722	cell differentiation
GO:0080090	0.714	regulation of primary metabolic process
GO:0048870	0.709	cell motility
GO:0051171	0.696	regulation of nitrogen compound metabolic process
GO:0009653	0.680	anatomical structure morphogenesis
GO:0007399	0.672	nervous system development
GO:0071704	0.626	organic substance metabolic process
GO:0044237	0.624	cellular metabolic process
GO:0042221	0.621	response to chemical
GO:0044238	0.620	primary metabolic process
GO:0009893	0.614	positive regulation of metabolic process
GO:0006807	0.586	nitrogen compound metabolic process
GO:0048583	0.575	regulation of response to stimulus
GO:0031325	0.552	positive regulation of cellular metabolic process
GO:0048519	0.544	negative regulation of biological process
GO:0048468	0.526	cell development
GO:0007166	0.519	cell surface receptor signaling pathway
GO:0043170	0.505	macromolecule metabolic process
GO:0010604	0.501	positive regulation of macromolecule metabolic process
GO:0007169	0.496	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0023051	0.492	regulation of signaling
GO:0010646	0.492	regulation of cell communication
GO:0010468	0.485	regulation of gene expression
GO:0051173	0.481	positive regulation of nitrogen compound metabolic process
GO:0048523	0.479	negative regulation of cellular process
GO:0009966	0.470	regulation of signal transduction
GO:0065009	0.469	regulation of molecular function
GO:0022008	0.449	neurogenesis
GO:0009889	0.440	regulation of biosynthetic process
GO:0048584	0.440	positive regulation of response to stimulus
GO:0048666	0.424	neuron development
GO:0010556	0.409	regulation of macromolecule biosynthetic process
GO:0045595	0.405	regulation of cell differentiation
GO:1901564	0.403	organonitrogen compound metabolic process
GO:0031326	0.383	regulation of cellular biosynthetic process
GO:0019219	0.377	regulation of nucleobase-containing compound metabolic process
GO:0051094	0.366	positive regulation of developmental process
GO:0051247	0.364	positive regulation of protein metabolic process
GO:0036211	0.362	protein modification process
GO:0051252	0.355	regulation of RNA metabolic process
GO:0023056	0.351	positive regulation of signaling
GO:0010647	0.351	positive regulation of cell communication
GO:0006355	0.349	regulation of DNA-templated transcription
GO:1902531	0.343	regulation of intracellular signal transduction
GO:0009967	0.343	positive regulation of signal transduction
GO:0044093	0.329	positive regulation of molecular function
GO:0050790	0.303	regulation of catalytic activity
GO:0070887	0.303	cellular response to chemical stimulus
GO:0042981	0.302	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0012505	0.994	endomembrane system
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0071944	0.987	cell periphery
GO:0005886	0.984	plasma membrane
GO:0031982	0.930	vesicle
GO:0005829	0.930	cytosol
GO:0032991	0.844	protein-containing complex
GO:0031410	0.696	cytoplasmic vesicle
GO:0005768	0.682	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.996	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.980	receptor protein-tyrosine kinase.

[back to server]