StarFunc result for job id P07954

User Input

>input (510 residues)
MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGEL
KVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAI
MKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDH
VNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAV
PLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAAL
TGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPE
NEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSA
RLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGS
TLKETAIELGYLTAEQFDEWVKPKDMLGPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10173	0.968	0.964	2.213E-71	512	0.945	0.941	P10173.pdb.gz	FUMH_PIG Fumarate hydratase, mitochondrial OS=Sus scrofa OX=9823 GN=FH PE=1 SV=2
2	PDB:7lubB	0.883	0.973	3.060E-66	462	0.906	1.000	7lubB.pdb.gz	Protein-metabolite interactomics of carbohydrate metabolism reveal regulation of lactate dehydrogenase.
3	AFDB:Q8SXM1	0.909	0.937	1.719E-60	495	0.712	0.733	Q8SXM1.pdb.gz	Q8SXM1_DROME fumarate hydratase OS=Drosophila melanogaster OX=7227 GN=Fum1 PE=2 SV=1
4	AFDB:O17214	0.896	0.912	1.021E-59	501	0.704	0.717	O17214.pdb.gz	FUMH_CAEEL Probable fumarate hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=fum-1 PE=3 SV=1
5	AFDB:O94552	0.905	0.888	2.445E-57	520	0.643	0.631	O94552.pdb.gz	FUMH_SCHPO Fumarate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fum1 PE=3 SV=3
6	AFDB:Q9FI53	0.894	0.914	1.814E-56	499	0.643	0.657	Q9FI53.pdb.gz	FUM2_ARATH Fumarate hydratase 2 OS=Arabidopsis thaliana OX=3702 GN=FUM2 PE=1 SV=1
7	AFDB:Q54VA2	0.895	0.940	1.472E-55	485	0.635	0.668	Q54VA2.pdb.gz	FUMH_DICDI Fumarate hydratase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=fumH PE=3 SV=1
8	AFDB:P08417	0.877	0.915	2.546E-54	488	0.627	0.656	P08417.pdb.gz	FUMH_YEAST Fumarate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUM1 PE=1 SV=2
9	PDB:1yfmA	0.874	0.990	1.322E-49	450	0.594	0.673	1yfmA.pdb.gz
10	PDB:6nzbA	0.885	0.976	1.651E-49	462	0.547	0.604	6nzbA.pdb.gz
11	AFDB:P05042	0.872	0.950	2.279E-49	467	0.549	0.600	P05042.pdb.gz	FUMC_ECOLI Fumarate hydratase class II OS=Escherichia coli (strain K12) OX=83333 GN=fumC PE=1 SV=1
12	AFDB:P9WN93	0.839	0.900	2.363E-43	474	0.467	0.502	P9WN93.pdb.gz	FUMC_MYCTU Fumarate hydratase class II OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fumC PE=1 SV=1
13	PDB:4apbD	0.831	0.913	6.232E-43	462	0.461	0.509	4apbD.pdb.gz	Conformational Changes Upon Ligand Binding in the Essential Class II Fumarase Rv1098C from Mycobacterium Tuberculosis.
14	AFDB:Q51404	0.853	0.948	1.023E-39	458	0.384	0.428	Q51404.pdb.gz	FUMC2_PSEAE Fumarate hydratase class II 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=fumC2 PE=1 SV=1
15	PDB:1jswB	0.839	0.927	1.842E-31	460	0.343	0.380	1jswB.pdb.gz
16	PDB:1tj7A	0.658	0.731	2.091E-15	455	0.147	0.165	1tj7A.pdb.gz	Structure determination and refinement at 2.44 A resolution of argininosuccinate lyase from Escherichia coli.
17	PDB:1i0aA	0.659	0.733	6.366E-15	453	0.153	0.172	1i0aA.pdb.gz
18	PDB:1k7wD	0.654	0.733	1.773E-14	450	0.153	0.173	1k7wD.pdb.gz	Mutational analysis of duck delta 2 crystallin and the structure of an inactive mutant with bound substrate provide insight into the enzymatic mechanism of argininosuccinate lyase.
19	PDB:6iemB	0.621	0.680	2.216E-14	462	0.157	0.173	6iemB.pdb.gz
20	PDB:1k62B	0.632	0.697	3.308E-14	459	0.137	0.153	1k62B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4C3	0.0	1051	510	1.000	1.000	A0A0S2Z4C3_HUMAN Fumarate hydratase, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=FH PE=2 SV=1
2	O17214	0.0	737	501	0.714	0.727	FUMH_CAEEL Probable fumarate hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=fum-1 PE=3 SV=1
3	O94552	0.0	666	520	0.625	0.613	FUMH_SCHPO Fumarate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fum1 PE=3 SV=3
4	P05042	0.0	568	467	0.549	0.600	FUMC_ECOLI Fumarate hydratase class II OS=Escherichia coli (strain K12) OX=83333 GN=fumC PE=1 SV=1
5	P07954	0.0	1051	510	1.000	1.000	FUMH_HUMAN Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH PE=1 SV=3
6	P08417	0.0	650	488	0.625	0.654	FUMH_YEAST Fumarate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUM1 PE=1 SV=2
7	P10173	0.0	954	512	0.945	0.941	FUMH_PIG Fumarate hydratase, mitochondrial OS=Sus scrofa OX=9823 GN=FH PE=1 SV=2
8	P14408	0.0	944	507	0.927	0.933	FUMH_RAT Fumarate hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fh PE=1 SV=2
9	P93033	0.0	681	492	0.657	0.681	FUM1_ARATH Fumarate hydratase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FUM1 PE=1 SV=2
10	P97807	0.0	926	507	0.890	0.895	FUMH_MOUSE Fumarate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Fh PE=1 SV=3
11	Q54VA2	0.0	661	485	0.635	0.668	FUMH_DICDI Fumarate hydratase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=fumH PE=3 SV=1
12	Q8IRQ5	0.0	756	467	0.706	0.771	Q8IRQ5_DROME fumarate hydratase OS=Drosophila melanogaster OX=7227 GN=Fum1 PE=1 SV=1
13	Q8SXM1	0.0	756	495	0.706	0.727	Q8SXM1_DROME fumarate hydratase OS=Drosophila melanogaster OX=7227 GN=Fum1 PE=2 SV=1
14	Q9FI53	0.0	689	499	0.643	0.657	FUM2_ARATH Fumarate hydratase 2 OS=Arabidopsis thaliana OX=3702 GN=FUM2 PE=1 SV=1
15	Q9W3X6	0.0	757	495	0.706	0.727	Q9W3X6_DROME fumarate hydratase OS=Drosophila melanogaster OX=7227 GN=Fum1 PE=1 SV=3
16	P9WN93	3.24e-145	427	474	0.467	0.502	FUMC_MYCTU Fumarate hydratase class II OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fumC PE=1 SV=1
17	Q51404	2.48e-118	357	458	0.384	0.428	FUMC2_PSEAE Fumarate hydratase class II 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=fumC2 PE=1 SV=1
18	P44324	4.08e-108	332	475	0.369	0.396	ASPA_HAEIN Aspartate ammonia-lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=aspA PE=3 SV=1
19	P0AC38	9.37e-103	318	478	0.351	0.374	ASPA_ECOLI Aspartate ammonia-lyase OS=Escherichia coli (strain K12) OX=83333 GN=aspA PE=1 SV=1
20	P39461	9.83e-100	309	438	0.351	0.409	FUMC_SACS2 Fumarate hydratase class II OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=fumC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10415 FumaraseC_C	2.1e-23	93.8	Fumarase C C-terminus
2	PF00206 Lyase_1	9.4e-123	421.2	Lyase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355518

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327070	0.997	Malate dehydrogenase, mitochondrial
2	9606.ENSP00000216254	0.994	Aconitate hydratase, mitochondrial
3	9606.ENSP00000264932	0.993	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
4	9606.ENSP00000364649	0.993	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
5	9606.ENSP00000342056	0.992	Citrate synthase, mitochondrial
6	9606.ENSP00000364699	0.992	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
7	9606.ENSP00000356953	0.989	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
8	9606.ENSP00000438144	0.988	Malate dehydrogenase, cytoplasmic
9	9606.ENSP00000245206	0.975	Aspartate aminotransferase, mitochondrial
10	9606.ENSP00000358719	0.966	Malic enzyme 1
11	9606.ENSP00000377446	0.966	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
12	9606.ENSP00000222673	0.958	2-oxoglutarate dehydrogenase, mitochondrial
13	9606.ENSP00000378408	0.958	Alanine aminotransferase 1
14	9606.ENSP00000440246	0.956	NADP-dependent malic enzyme, mitochondrial
15	9606.ENSP00000345282	0.954	Alanine aminotransferase 2
16	9606.ENSP00000205402	0.952	Dihydrolipoyl dehydrogenase, mitochondrial
17	9606.ENSP00000229270	0.952	Triosephosphate isomerase 1
18	9606.ENSP00000321070	0.952	NAD-dependent malic enzyme, mitochondrial
19	9606.ENSP00000359539	0.943	Aspartate aminotransferase, cytoplasmic
20	9606.ENSP00000296417	0.934	Histone H2A.Z

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004333	1.000	fumarate hydratase activity
GO:0005515	0.993	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044281	0.988	small molecule metabolic process
GO:0043648	0.946	dicarboxylic acid metabolic process
GO:0044238	0.766	primary metabolic process
GO:0065007	0.337	biological regulation
GO:0006091	0.333	generation of precursor metabolites and energy
GO:0050789	0.326	regulation of biological process
GO:0006807	0.300	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.906	intracellular organelle lumen
GO:0005829	0.748	cytosol
GO:0005759	0.441	mitochondrial matrix
GO:0031981	0.367	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12460	1.000	(S)-malate = fumarate + H2O
EC:4.2.1.2	1.000	fumarate hydratase.

[back to server]