StarFunc result for job id P07992

User Input

>input (297 residues)
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTY
AEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVP
WEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQ
ALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLT
TVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0Q6	0.784	0.784	1.807E-52	297	1.000	1.000	A0A024R0Q6.pdb.gz
2	AFDB:D3ZAQ9	0.597	0.595	4.093E-47	298	0.838	0.836	D3ZAQ9.pdb.gz	D3ZAQ9_RAT ERCC excision repair 1, endonuclease non-catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ercc1 PE=3 SV=1
3	AFDB:Q9MA98	0.542	0.408	3.196E-30	410	0.428	0.310	Q9MA98.pdb.gz	ERCC1_ARATH DNA excision repair protein ERCC-1 OS=Arabidopsis thaliana OX=3702 GN=ERCC1 PE=2 SV=1
4	AFDB:Q7KMG7	0.534	0.601	7.810E-30	259	0.380	0.436	Q7KMG7.pdb.gz	Q7KMG7_DROME Ercc1 OS=Drosophila melanogaster OX=7227 GN=Ercc1 PE=3 SV=1
5	PDB:6sxaG	0.435	0.622	4.107E-29	196	0.660	1.000	6sxaG.pdb.gz
6	AFDB:Q06182	0.511	0.585	3.017E-27	252	0.354	0.417	Q06182.pdb.gz	SWI10_SCHPO Mating-type switching protein swi10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swi10 PE=1 SV=1
7	AFDB:Q5AA15	0.516	0.462	7.696E-22	338	0.293	0.257	Q5AA15.pdb.gz	Q5AA15_CANAL Rad10p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD10 PE=3 SV=1
8	AFDB:Q93456	0.522	0.581	4.691E-20	262	0.239	0.271	Q93456.pdb.gz	Q93456_CAEEL ERCC4 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ercc-1 PE=1 SV=2
9	AFDB:A0A0S2Z5V6	0.525	0.692	6.474E-13	215	0.131	0.181	A0A0S2Z5V6.pdb.gz	A0A0S2Z5V6_HUMAN Chromosome 19 open reading frame 40 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=C19orf40 PE=2 SV=1
10	PDB:4bxoB	0.473	0.669	9.371E-12	196	0.125	0.189	4bxoB.pdb.gz	Architecture and DNA Recognition Elements of the Fanconi Anemia Fancm-Faap24 Complex.
11	AFDB:Q8TZH8	0.348	0.144	1.351E-11	764	0.155	0.060	Q8TZH8.pdb.gz	Q8TZH8_PYRFU ATP-dependent RNA helicase, putative OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF2015 PE=1 SV=1
12	AFDB:Q8IYD8	0.363	0.058	2.450E-11	2048	0.152	0.022	Q8IYD8.pdb.gz	FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
13	PDB:6sxaF	0.322	0.138	1.170E-6	747	0.138	0.055	6sxaF.pdb.gz
14	PDB:6sxbF	0.308	0.139	6.200E-6	701	0.135	0.057	6sxbF.pdb.gz	Cryo-EM structures of the XPF-ERCC1 endonuclease reveal how DNA-junction engagement disrupts an auto-inhibited conformation.
15	PDB:7f6lB	0.350	0.365	6.716E-5	282	0.155	0.163	7f6lB.pdb.gz
16	PDB:1qo0E	0.185	0.257	1.270E-2	194	0.098	0.149	1qo0E.pdb.gz	Crystal Structure and Induction Mechanism of Amic-Amir: A Ligand-Regulated Transcription Antitermination Complex
17	PDB:5wc1A	0.166	0.184	3.495E-2	262	0.084	0.095	5wc1A.pdb.gz
18	PDB:3jc54	0.155	0.095	5.974E-2	569	0.094	0.049	3jc54.pdb.gz
19	PDB:2owoA	0.199	0.103	6.729E-2	586	0.061	0.031	2owoA.pdb.gz	Last Stop on the Road to Repair: Structure of E. coli DNA Ligase Bound to Nicked DNA-Adenylate.
20	PDB:2plaA	0.184	0.165	7.581E-2	343	0.077	0.067	2plaA.pdb.gz	Crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZAQ9	0.0	514	298	0.838	0.836	D3ZAQ9_RAT ERCC excision repair 1, endonuclease non-catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ercc1 PE=3 SV=1
2	K7EP14	0.0	530	258	0.869	1.000	K7EP14_HUMAN ERCC excision repair 1, endonuclease non-catalytic subunit (Fragment) OS=Homo sapiens OX=9606 GN=ERCC1 PE=1 SV=1
3	P07903	0.0	525	298	0.862	0.859	ERCC1_MOUSE DNA excision repair protein ERCC-1 OS=Mus musculus OX=10090 GN=Ercc1 PE=2 SV=2
4	P07992	0.0	608	297	1.000	1.000	ERCC1_HUMAN DNA excision repair protein ERCC-1 OS=Homo sapiens OX=9606 GN=ERCC1 PE=1 SV=1
5	K7ER89	4.36e-174	482	234	0.788	1.000	K7ER89_HUMAN ERCC excision repair 1, endonuclease non-catalytic subunit (Fragment) OS=Homo sapiens OX=9606 GN=ERCC1 PE=1 SV=1
6	A0A8I6GI31	2.77e-164	460	295	0.751	0.756	A0A8I6GI31_RAT ERCC excision repair 1, endonuclease non-catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ercc1 PE=3 SV=1
7	K7ER60	1.23e-147	414	213	0.677	0.944	K7ER60_HUMAN ERCC excision repair 1, endonuclease non-catalytic subunit OS=Homo sapiens OX=9606 GN=ERCC1 PE=1 SV=1
8	A0A8I6A2U2	1.81e-139	395	245	0.640	0.776	A0A8I6A2U2_RAT ERCC excision repair 1, endonuclease non-catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ercc1 PE=3 SV=1
9	Q9MA98	2.09e-81	253	410	0.404	0.293	ERCC1_ARATH DNA excision repair protein ERCC-1 OS=Arabidopsis thaliana OX=3702 GN=ERCC1 PE=2 SV=1
10	Q06182	3.52e-76	234	252	0.343	0.405	SWI10_SCHPO Mating-type switching protein swi10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swi10 PE=1 SV=1
11	Q95S37	4.76e-75	231	244	0.377	0.459	Q95S37_DROME GM10122p OS=Drosophila melanogaster OX=7227 GN=Ercc1 PE=2 SV=1
12	Q7KMG7	8.66e-75	231	259	0.377	0.432	Q7KMG7_DROME Ercc1 OS=Drosophila melanogaster OX=7227 GN=Ercc1 PE=3 SV=1
13	Q93456	1.67e-38	138	262	0.229	0.260	Q93456_CAEEL ERCC4 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ercc-1 PE=1 SV=2
14	Q5AA15	2.15e-29	116	338	0.283	0.249	Q5AA15_CANAL Rad10p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD10 PE=3 SV=1
15	P06838	4.84e-16	77.4	210	0.178	0.252	RAD10_YEAST DNA repair protein RAD10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD10 PE=1 SV=1
16	Q8TZH8	0.003	41.6	764	0.094	0.037	Q8TZH8_PYRFU ATP-dependent RNA helicase, putative OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF2015 PE=1 SV=1
17	F4IDW9	0.024	38.1	250	0.061	0.072	PTD_ARATH Protein PARTING DANCERS OS=Arabidopsis thaliana OX=3702 GN=PTD PE=1 SV=1
18	P9WNV1	0.28	35.4	691	0.057	0.025	DNLJ_MYCTU DNA ligase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ligA PE=1 SV=1
19	Q6DR03	3.4	32.0	565	0.104	0.055	ZDHC3_ARATH Protein S-acyltransferase 21 OS=Arabidopsis thaliana OX=3702 GN=PAT21 PE=2 SV=1
20	Q8VZ40	5.1	31.2	632	0.057	0.027	PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana OX=3702 GN=PUB14 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14842 FliG_N	6.6e+02	12.3	FliG N-terminal domain
2	PF00633 HHH	0.026	25.6	Helix-hairpin-helix motif
3	PF12826 HHH_2	0.32	22.5	Helix-hairpin-helix motif
4	PF14520 HHH_5	0.012	27.5	Helix-hairpin-helix domain
5	PF03834 Rad10	2.2e-46	167.9	Binding domain of DNA repair protein Ercc1 (rad10/Swi10)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000045044

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000053757	0.999	Excision repair cross-complementing rodent repair deficiency, complementation group 4
2	9598.ENSPTRP00000036174	0.995	Uncharacterized protein
3	9598.ENSPTRP00000013163	0.993	Uncharacterized protein
4	9598.ENSPTRP00000010694	0.990	Uncharacterized protein
5	9598.ENSPTRP00000006717	0.971	Uncharacterized protein
6	9598.ENSPTRP00000053370	0.949	ERCC excision repair 5, endonuclease
7	9598.ENSPTRP00000014483	0.935	Uncharacterized protein
8	9598.ENSPTRP00000018486	0.914	Uncharacterized protein
9	9598.ENSPTRP00000019135	0.913	TFIIH basal transcription factor complex helicase subunit
10	9598.ENSPTRP00000015960	0.907	Uncharacterized protein
11	9598.ENSPTRP00000041690	0.905	Uncharacterized protein
12	9598.ENSPTRP00000012702	0.903	Uncharacterized protein
13	9598.ENSPTRP00000025203	0.903	Fanconi anemia, complementation group D2
14	9598.ENSPTRP00000003664	0.902	Exonuclease 1
15	9598.ENSPTRP00000016620	0.889	Uncharacterized protein
16	9598.ENSPTRP00000049816	0.886	Ubiquitinyl hydrolase 1
17	9598.ENSPTRP00000048051	0.880	Damage-specific DNA binding protein 1, 127kDa
18	9598.ENSPTRP00000014573	0.876	Replication protein A subunit
19	9598.ENSPTRP00000001939	0.873	DNA cross-link repair 1B
20	9598.ENSPTRP00000006454	0.873	Flap endonuclease 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140097	0.997	catalytic activity, acting on DNA
GO:0003677	0.997	DNA binding
GO:0003684	0.994	damaged DNA binding
GO:0003697	0.993	single-stranded DNA binding
GO:0000014	0.993	single-stranded DNA endodeoxyribonuclease activity
GO:0019904	0.891	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006950	0.995	response to stress
GO:0044238	0.992	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0016043	0.985	cellular component organization
GO:0006281	0.981	DNA repair
GO:0006302	0.968	double-strand break repair
GO:0006996	0.962	organelle organization
GO:0050794	0.959	regulation of cellular process
GO:0019222	0.956	regulation of metabolic process
GO:0033044	0.954	regulation of chromosome organization
GO:0060255	0.941	regulation of macromolecule metabolic process
GO:0051052	0.933	regulation of DNA metabolic process
GO:0032204	0.914	regulation of telomere maintenance
GO:0006310	0.898	DNA recombination
GO:0006289	0.867	nucleotide-excision repair
GO:0051276	0.860	chromosome organization
GO:0048519	0.673	negative regulation of biological process
GO:0048583	0.645	regulation of response to stimulus
GO:0048523	0.581	negative regulation of cellular process
GO:0032502	0.573	developmental process
GO:0048518	0.542	positive regulation of biological process
GO:0000723	0.448	telomere maintenance
GO:0032501	0.446	multicellular organismal process
GO:0048522	0.413	positive regulation of cellular process
GO:2001020	0.384	regulation of response to DNA damage stimulus
GO:0010604	0.308	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.932	intracellular non-membrane-bounded organelle
GO:0032991	0.865	protein-containing complex
GO:0005737	0.302	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.994	Acting on ester bonds.

[back to server]