StarFunc result for job id P07996

User Input

>input (1170 residues)
MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JV24	0.540	0.549	0.000	1152	0.904	0.918	A0A0G2JV24.pdb.gz	A0A0G2JV24_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=1 SV=2
2	AFDB:D4A2G6	0.632	0.631	0.000	1172	0.619	0.618	D4A2G6.pdb.gz	D4A2G6_RAT Thrombospondin 2 OS=Rattus norvegicus OX=10116 GN=Thbs2 PE=3 SV=2
3	AFDB:P35442	0.669	0.668	0.000	1172	0.619	0.618	P35442.pdb.gz	TSP2_HUMAN Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2
4	AFDB:P49744	0.428	0.510	1.492E-89	980	0.345	0.412	P49744.pdb.gz	TSP4_RAT Thrombospondin-4 OS=Rattus norvegicus OX=10116 GN=Thbs4 PE=1 SV=1
5	AFDB:P49746	0.429	0.524	1.919E-87	956	0.336	0.411	P49746.pdb.gz	TSP3_HUMAN Thrombospondin-3 OS=Homo sapiens OX=9606 GN=THBS3 PE=1 SV=1
6	AFDB:Q8JHW2	0.423	0.513	5.068E-87	962	0.332	0.404	Q8JHW2.pdb.gz	TSP3A_DANRE Thrombospondin-3a OS=Danio rerio OX=7955 GN=thbs3a PE=2 SV=2
7	AFDB:Q968S4	0.429	0.473	2.232E-86	1060	0.327	0.361	Q968S4.pdb.gz	Q968S4_DROME Putative thrombospondin OS=Drosophila melanogaster OX=7227 GN=Tsp PE=2 SV=1
8	AFDB:Q8JGW0	0.430	0.529	3.028E-85	949	0.335	0.413	Q8JGW0.pdb.gz	TSP4B_DANRE Thrombospondin-4-B OS=Danio rerio OX=7955 GN=thbs4b PE=2 SV=1
9	AFDB:P49747	0.431	0.663	1.630E-82	757	0.304	0.470	P49747.pdb.gz	COMP_HUMAN Cartilage oligomeric matrix protein OS=Homo sapiens OX=9606 GN=COMP PE=1 SV=2
10	AFDB:Q90827	0.160	0.224	1.077E-27	816	0.115	0.165	Q90827.pdb.gz	NEL_CHICK Protein NEL OS=Gallus gallus OX=9031 GN=NEL PE=2 SV=1
11	PDB:1w0rA	0.087	0.188	6.556E-13	442	0.074	0.195	1w0rA.pdb.gz
12	PDB:3t5oA	0.046	0.061	5.838E-6	871	0.050	0.067	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
13	PDB:4e0sB	0.054	0.069	1.392E-5	898	0.031	0.040	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
14	PDB:7ufgB	0.111	0.110	1.392E-5	1182	0.022	0.022	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
15	PDB:7ufgA	0.104	0.106	2.706E-5	1151	0.022	0.023	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
16	PDB:5n0cA	0.107	0.098	3.320E-5	1293	0.033	0.030	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
17	PDB:3v0aB	0.100	0.102	4.512E-5	1150	0.023	0.023	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
18	PDB:4a5wB	0.046	0.061	5.827E-5	871	0.026	0.034	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
19	PDB:7qfqA	0.109	0.100	7.149E-5	1291	0.029	0.026	7qfqA.pdb.gz
20	PDB:4uflA	0.111	0.190	7.919E-5	641	0.026	0.047	4uflA.pdb.gz	Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JV24	0.0	2237	1171	0.955	0.954	A0A0G2JV24_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=1 SV=2
2	D4A2G6	0.0	1486	1172	0.618	0.617	D4A2G6_RAT Thrombospondin 2 OS=Rattus norvegicus OX=10116 GN=Thbs2 PE=3 SV=2
3	F1SS26	0.0	2368	1170	0.977	0.977	F1SS26_PIG Thrombospondin 1 OS=Sus scrofa OX=9823 GN=THBS1 PE=1 SV=2
4	P07996	0.0	2412	1170	1.000	1.000	TSP1_HUMAN Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1 PE=1 SV=2
5	P35441	0.0	2216	1170	0.948	0.948	TSP1_MOUSE Thrombospondin-1 OS=Mus musculus OX=10090 GN=Thbs1 PE=1 SV=1
6	P35442	0.0	1452	1172	0.621	0.619	TSP2_HUMAN Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2
7	P35443	0.0	614	961	0.305	0.371	TSP4_HUMAN Thrombospondin-4 OS=Homo sapiens OX=9606 GN=THBS4 PE=1 SV=2
8	P35444	0.0	621	755	0.308	0.477	COMP_RAT Cartilage oligomeric matrix protein OS=Rattus norvegicus OX=10116 GN=Comp PE=1 SV=1
9	P49744	0.0	610	980	0.304	0.363	TSP4_RAT Thrombospondin-4 OS=Rattus norvegicus OX=10116 GN=Thbs4 PE=1 SV=1
10	P49746	0.0	627	956	0.303	0.370	TSP3_HUMAN Thrombospondin-3 OS=Homo sapiens OX=9606 GN=THBS3 PE=1 SV=1
11	P49747	0.0	621	757	0.305	0.472	COMP_HUMAN Cartilage oligomeric matrix protein OS=Homo sapiens OX=9606 GN=COMP PE=1 SV=2
12	Q03350	0.0	1484	1172	0.622	0.621	TSP2_MOUSE Thrombospondin-2 OS=Mus musculus OX=10090 GN=Thbs2 PE=1 SV=2
13	Q05895	0.0	626	956	0.303	0.371	TSP3_MOUSE Thrombospondin-3 OS=Mus musculus OX=10090 GN=Thbs3 PE=1 SV=2
14	Q71SA3	0.0	2236	1170	0.952	0.952	Q71SA3_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=2 SV=1
15	Q8JGW0	0.0	582	949	0.297	0.367	TSP4B_DANRE Thrombospondin-4-B OS=Danio rerio OX=7955 GN=thbs4b PE=2 SV=1
16	Q8JHW2	0.0	608	962	0.297	0.362	TSP3A_DANRE Thrombospondin-3a OS=Danio rerio OX=7955 GN=thbs3a PE=2 SV=2
17	Q9R0G6	0.0	621	755	0.308	0.477	COMP_MOUSE Cartilage oligomeric matrix protein OS=Mus musculus OX=10090 GN=Comp PE=1 SV=2
18	Q9Z1T2	0.0	601	963	0.303	0.368	TSP4_MOUSE Thrombospondin-4 OS=Mus musculus OX=10090 GN=Thbs4 PE=1 SV=1
19	Q968S4	1.28e-178	555	1060	0.273	0.301	Q968S4_DROME Putative thrombospondin OS=Drosophila melanogaster OX=7227 GN=Tsp PE=2 SV=1
20	Q9VM97	1.48e-177	552	1060	0.272	0.300	Q9VM97_DROME Thrombospondin, isoform A OS=Drosophila melanogaster OX=7227 GN=Tsp PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	0.034	25.4	Complement Clr-like EGF-like
2	PF00008 EGF	5.9	18.6	EGF-like domain
3	PF12947 EGF_3	0.005	28.3	EGF domain
4	PF07645 EGF_CA	0.033	25.7	Calcium-binding EGF domain
5	PF00054 Laminin_G_1	1.7e+02	13.8	Laminin G domain
6	PF02210 Laminin_G_2	0.67	22.0	Laminin G domain
7	PF13385 Laminin_G_3	0.21	23.1	Concanavalin A-like lectin/glucanases superfamily
8	PF19030 TSP1_ADAMTS	0.04	25.5	Thrombospondin type 1 domain
9	PF19035 TSP1_CCN	0.81	21.4	CCN3 Nov like TSP1 domain
10	PF19028 TSP1_spondin	8e-20	82.2	Spondin-like TSP1 domain
11	PF00090 TSP_1	1.7e-38	141.8	Thrombospondin type 1 domain
12	PF02412 TSP_3	7.8e-57	200.0	Thrombospondin type 3 repeat
13	PF05735 TSP_C	3e-90	312.9	Thrombospondin C-terminal region
14	PF00093 VWC	8.9e-09	46.9	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260356

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355361	0.999	Leukocyte surface antigen CD47
2	9606.ENSP00000346839	0.998	Fibronectin type III domain containing
3	9606.ENSP00000320866	0.990	Calreticulin
4	9606.ENSP00000361818	0.990	Syndecan-4
5	9606.ENSP00000399421	0.989	Platelet glycoprotein 4
6	9606.ENSP00000243077	0.981	Prolow-density lipoprotein receptor-related protein 1
7	9606.ENSP00000303634	0.978	Low-density lipoprotein receptor-related protein 8
8	9606.ENSP00000370542	0.974	Syndecan-1
9	9606.ENSP00000392500	0.973	Neuroligin-1
10	9606.ENSP00000452786	0.971	Integrin beta-3
11	9606.ENSP00000361405	0.964	Matrix metalloproteinase-9
12	9606.ENSP00000379350	0.963	Integrin beta-1
13	9606.ENSP00000339613	0.961	GDP-fucose protein O-fucosyltransferase 2
14	9606.ENSP00000219070	0.956	72 kDa type IV collagenase
15	9606.ENSP00000343002	0.949	Beta-1,3-glucosyltransferase
16	9606.ENSP00000386043	0.948	Latent-transforming growth factor beta-binding protein 1
17	9606.ENSP00000007722	0.945	Integrin alpha-3
18	9606.ENSP00000294728	0.944	Vascular cell adhesion protein 1
19	9606.ENSP00000422554	0.939	A disintegrin and metalloproteinase with thrombospondin motifs 12
20	9606.ENSP00000373472	0.935	A disintegrin and metalloproteinase with thrombospondin motifs 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019838	0.998	growth factor binding
GO:0050431	0.990	transforming growth factor beta binding
GO:0050840	0.973	extracellular matrix binding
GO:0008201	0.930	heparin binding
GO:0044877	0.882	protein-containing complex binding
GO:0005102	0.766	signaling receptor binding
GO:0005518	0.424	collagen binding
GO:0043394	0.363	proteoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050789	0.995	regulation of biological process
GO:0009987	0.991	cellular process
GO:0009719	0.991	response to endogenous stimulus
GO:0048519	0.989	negative regulation of biological process
GO:0001817	0.988	regulation of cytokine production
GO:0010033	0.986	response to organic substance
GO:0048518	0.985	positive regulation of biological process
GO:0051716	0.981	cellular response to stimulus
GO:0016525	0.981	negative regulation of angiogenesis
GO:0034612	0.965	response to tumor necrosis factor
GO:0071634	0.965	regulation of transforming growth factor beta production
GO:1901654	0.964	response to ketone
GO:0070848	0.941	response to growth factor
GO:0050678	0.928	regulation of epithelial cell proliferation
GO:0010594	0.926	regulation of endothelial cell migration
GO:0014070	0.921	response to organic cyclic compound
GO:0048583	0.918	regulation of response to stimulus
GO:0001936	0.915	regulation of endothelial cell proliferation
GO:0032501	0.914	multicellular organismal process
GO:0040017	0.906	positive regulation of locomotion
GO:0010604	0.906	positive regulation of macromolecule metabolic process
GO:0070887	0.903	cellular response to chemical stimulus
GO:0051240	0.903	positive regulation of multicellular organismal process
GO:0033993	0.896	response to lipid
GO:0071310	0.887	cellular response to organic substance
GO:0048523	0.884	negative regulation of cellular process
GO:0033574	0.882	response to testosterone
GO:0032502	0.877	developmental process
GO:0040013	0.875	negative regulation of locomotion
GO:0071495	0.873	cellular response to endogenous stimulus
GO:0048856	0.869	anatomical structure development
GO:0090287	0.869	regulation of cellular response to growth factor stimulus
GO:0030336	0.867	negative regulation of cell migration
GO:0030335	0.856	positive regulation of cell migration
GO:0080090	0.847	regulation of primary metabolic process
GO:0051171	0.845	regulation of nitrogen compound metabolic process
GO:0010596	0.820	negative regulation of endothelial cell migration
GO:0010646	0.809	regulation of cell communication
GO:0071363	0.800	cellular response to growth factor stimulus
GO:0010628	0.799	positive regulation of gene expression
GO:0048584	0.796	positive regulation of response to stimulus
GO:0051246	0.790	regulation of protein metabolic process
GO:1904018	0.763	positive regulation of vasculature development
GO:0023051	0.761	regulation of signaling
GO:0030155	0.758	regulation of cell adhesion
GO:0045766	0.752	positive regulation of angiogenesis
GO:0032101	0.745	regulation of response to external stimulus
GO:0007275	0.745	multicellular organism development
GO:0051128	0.729	regulation of cellular component organization
GO:0050920	0.716	regulation of chemotaxis
GO:0050921	0.700	positive regulation of chemotaxis
GO:0009966	0.675	regulation of signal transduction
GO:0001819	0.675	positive regulation of cytokine production
GO:0006950	0.651	response to stress
GO:0008285	0.643	negative regulation of cell population proliferation
GO:0051173	0.632	positive regulation of nitrogen compound metabolic process
GO:0050680	0.623	negative regulation of epithelial cell proliferation
GO:0009605	0.613	response to external stimulus
GO:0001937	0.605	negative regulation of endothelial cell proliferation
GO:0071356	0.572	cellular response to tumor necrosis factor
GO:1901888	0.521	regulation of cell junction assembly
GO:0031323	0.481	regulation of cellular metabolic process
GO:0007165	0.475	signal transduction
GO:0065008	0.470	regulation of biological quality
GO:0009892	0.468	negative regulation of metabolic process
GO:0010605	0.459	negative regulation of macromolecule metabolic process
GO:0010941	0.428	regulation of cell death
GO:0009612	0.427	response to mechanical stimulus
GO:0071704	0.426	organic substance metabolic process
GO:0048585	0.423	negative regulation of response to stimulus
GO:0023056	0.421	positive regulation of signaling
GO:0010647	0.421	positive regulation of cell communication
GO:0009967	0.406	positive regulation of signal transduction
GO:0071840	0.404	cellular component organization or biogenesis
GO:1902531	0.403	regulation of intracellular signal transduction
GO:0031325	0.402	positive regulation of cellular metabolic process
GO:0048731	0.390	system development
GO:0043067	0.388	regulation of programmed cell death
GO:0042981	0.374	regulation of apoptotic process
GO:0002682	0.368	regulation of immune system process
GO:0080134	0.368	regulation of response to stress
GO:0010634	0.348	positive regulation of epithelial cell migration
GO:0008284	0.345	positive regulation of cell population proliferation
GO:0060548	0.331	negative regulation of cell death
GO:0010595	0.330	positive regulation of endothelial cell migration
GO:0016043	0.326	cellular component organization
GO:0002684	0.318	positive regulation of immune system process
GO:0010810	0.317	regulation of cell-substrate adhesion
GO:0065009	0.310	regulation of molecular function
GO:0043069	0.308	negative regulation of programmed cell death
GO:0017015	0.301	regulation of transforming growth factor beta receptor signaling pathway
GO:0043170	0.300	macromolecule metabolic process
GO:0043066	0.300	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0071944	0.998	cell periphery
GO:0005615	0.998	extracellular space
GO:0012505	0.996	endomembrane system
GO:0043227	0.989	membrane-bounded organelle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0070013	0.918	intracellular organelle lumen
GO:0031012	0.874	extracellular matrix
GO:0062023	0.847	collagen-containing extracellular matrix
GO:0031982	0.691	vesicle
GO:0005783	0.435	endoplasmic reticulum
GO:0065010	0.375	extracellular membrane-bounded organelle
GO:0005886	0.348	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]